KEGG   Paenibacillus sp. FSL P4-0081: P40081_33730Help
Entry
P40081_33730      CDS       T03332                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
paen  Paenibacillus sp. FSL P4-0081
Pathway
paen00620  Pyruvate metabolism
paen00680  Methane metabolism
paen01100  Metabolic pathways
paen01120  Microbial metabolism in diverse environments
paen01200  Carbon metabolism
Module
paen_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:paen00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    P40081_33730
  Energy metabolism
   00680 Methane metabolism
    P40081_33730
Enzymes [BR:paen01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     P40081_33730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 OTCace
Motif
Other DBs
NCBI-ProteinID: AIQ32512
LinkDB All DBs
Position
complement(7619789..7622581)
Genome map
AA seq 930 aa AA seqDB search
MTELTTTVSKSNSNNLLRRDVRFLGNILGEVLVHQGGNELLDIVEKIRETSKSLRSLFLP
ELHNEFKELISSLDTENRHQVIRAFAIYFQLVNIAEQNHRIRRKRDYERSAGETVQPGSI
ESAIQELRERDFSHEDVHEIMNGLSLELVMTAHPTEAMRRAILDIHKRISDDVMGLDNPT
LTFREREQLREKLLNEVITLWQTDELRDRKPTVLDEVRNGMYYFHETIFEVLPDVYQELE
RCLSKYYPGQNWHVPTYLRFGSWIGGDRDGNPSVTAAVTLQTLRLQRKLAIREYQRIMRE
LMQYLSFSTSIVNVTPELLESIEKDRNIINLNRVDAWRNDNEPYRIKLSYMISKTQNVLD
DEKKGTPERYSSPEQFIDDLNVIDRSLRHHYADYVADTYIKKLIRQVELFGFHTSTLDVR
QHSQEHENAMTEILAKMNVTPDYSKLEEKQKIELLEKLLNDPRPLTSPYQSYSEGTEECL
AVYRTIFQAQEEYGKQCITSYLISMAEAASDILEVMVFSKEVGLFRKDNDGTVVCTLQAV
PLFETIDDLHDAPQIMHTLLSMPIYRDAVTAMNDLQEIMLGYSDSNKDGGVVTANWELRV
ALKQITATADEFGIKLKFFHGRGGALGRGGMPLNRSILAQPASTIGGGIKITEQGEVISS
RYSMKGIAYRSLEQATSALVTAAIHARSPQADLYEAKWDEIIARISEVSLNKYQDLIFRD
PDFLTYFKESTPLPEVGELNIGSRPSKRKNSERFEDLRAIPWVFAWTQSRYLLPAWYAAG
TGLQSFYEDKEENLKIMQHMYANFSFFTTLIDTLQMAIAKADLVIAKEYAGMGKNEEARV
RIFGQIEAEFKLTSELILKITGQQDILDNVPVIQESIRLRNPYVDPLSYLQVQLLAELRA
LRDVEGDDAELLREVLLTINGIAAGLRNTG
NT seq 2793 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaacttacgactaccgttagcaaaagcaactccaataatctgctgcggcgggac
gtacggttcctggggaatattctgggcgaagtcttggtacaccaaggcggcaacgaactg
ctggatatcgtggagaagatccgtgaaaccagtaaatcgctgcgctcattgtttttgcct
gaactgcacaatgaatttaaagagctaattagttcactggatacggagaaccggcatcag
gtgatacgggctttcgccatttattttcaattggtgaacatagccgagcagaatcaccgc
attcgccgtaagcgcgattatgaacgttctgccggggagaccgtacagccagggtcgatc
gaaagcgcgattcaggagctccgcgagcgggatttctcccacgaggatgttcatgagatc
atgaacggcctgtctctggaactagttatgacggctcaccctacggaagccatgcgccgt
gcgattctcgatatccacaaacggatctccgatgatgtcatgggactggataatccgact
ctgactttccgcgaacgcgaacagctccgtgagaagctgctgaatgaagtaattaccctg
tggcagacggatgagttacgtgaccgcaagcctaccgtgctcgatgaagtgcgcaatggc
atgtattatttccatgagacgatttttgaagtgttgccggatgtgtatcaagagcttgag
cgatgtctaagcaaatattatccgggccagaactggcatgtgccgacctatctgcgtttc
ggttcatggattggcggcgaccgtgacggtaacccttcggtgactgcggccgtaaccttg
cagacgctgcgtctgcagcgcaagctggctattcgtgaatatcagcggattatgcgcgaa
ttaatgcagtacctgagctttagtacaagcatcgtcaatgtgacgccggagctgctggag
tccattgagaaggaccgtaacattatcaatcttaaccgggttgatgcctggcgcaatgat
aatgaaccttaccggattaagctcagctatatgatctccaagacacagaatgttctggat
gatgagaaaaaaggtacgcctgagcgctattcctcaccagagcaatttatagatgatttg
aacgtgattgaccgcagcctgcggcatcactatgccgactatgtagcagacacctatatt
aagaagctaatccgccaagtggagctgttcggcttccatacgtcgaccctggatgtccgc
cagcacagccaagaacatgagaatgcgatgacggagatcctggccaaaatgaatgttaca
ccggattactctaagctggaggagaaacaaaagattgagctgctcgaaaagctgctgaat
gatccgcgtccgctgacatccccttaccagtcttatagtgaaggtacggaggaatgcctt
gcggtataccggacgatcttccaggcgcaggaggaatacggcaagcagtgtatcacaagc
tatctgatcagtatggcggaagcagccagtgatattcttgaggtcatggtattctccaaa
gaagtgggcctgttccgcaaagacaacgacggtacggttgtatgtactttgcaggcggtg
ccgctgtttgaaaccattgacgacctccatgatgcaccacagattatgcatacgctgctc
agcatgccgatctaccgcgatgcagttactgcaatgaatgatctgcaggaaatcatgctc
ggttattcggacagtaataaagacggtggtgtggttactgcgaactgggagctgcgcgtt
gccctgaagcagattacagcgactgccgatgaattcggcattaagctgaagttcttccac
ggacgcggcggagccctcggacgtggcggtatgccgctgaaccggagtattctggcccag
ccggcttccaccattggcggtggtatcaagattaccgagcagggggaggttatctcttcc
cggtattcaatgaaaggcattgcttaccgcagtctggagcaggcgacatctgctctggtt
acggcggcgattcatgccagatcgccacaggcggatctgtatgaagcgaagtgggatgag
attattgcccgcatctctgaagtctccctgaacaaatatcaggatctgatcttccgtgat
ccggatttcctgacgtacttcaaagaatcaaccccgctgccggaggttggggaactgaat
atcggttcacgtccttcgaagcgtaagaacagtgaacgcttcgaggatctgcgtgccatc
ccttgggtattcgcctggacccagagccgttatctgctgcctgcatggtatgcggccggt
actggactgcagagcttctatgaggataaagaagagaacctgaagatcatgcagcatatg
tatgccaacttctctttcttcacgaccttgatcgataccctgcagatggctattgccaag
gcggatctcgtaatcgccaaggaatatgccggcatgggcaaaaacgaagaggcgcgggtg
cgtatcttcggccagatcgaagccgagttcaagctgacctccgagctcatcctgaagatt
accggccagcaggatattctggataatgttccagttattcaggagtcgatccgcctgcgt
aacccgtatgttgatccgctcagctacctgcaggtccagctccttgccgagcttcgcgcc
ctgcgcgatgtggagggcgatgacgctgagctgctgcgtgaggtgctgcttacgatcaac
ggtattgccgccggccttcggaataccggctga

DBGET integrated database retrieval system