KEGG   Pseudomonas aeruginosa PAO581: M801_3676Help
Entry
M801_3676         CDS       T03171                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase family protein
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
paeo  Pseudomonas aeruginosa PAO581
Pathway
paeo00620  Pyruvate metabolism
paeo00680  Methane metabolism
paeo01100  Metabolic pathways
paeo01120  Microbial metabolism in diverse environments
paeo01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:paeo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    M801_3676
  09102 Energy metabolism
   00680 Methane metabolism
    M801_3676
Enzymes [BR:paeo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     M801_3676
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AGV59292
LinkDB All DBs
Position
complement(3907339..3909975)
Genome map
AA seq 878 aa AA seqDB search
MPEIDARLREDVHQLGELLGDTIREQYGPRFLDKIELIRKGAKAARRGSAEGAQQLTATL
DGLEEDELLPVARAFNQFLNLANIAEQYHRIRRRRPNEPEPFENLVLEELLGRLKDAGHA
PGQLARQLAGLEIELVLTAHPTEVARRTLIQKYDAITAQLAAKDHADLLPEERSRIQQRL
QRLVAEAWHTDEIRKVRPTPVDEAKWGFAVIEHSLWQALPNVLRHVDEVLLRSTGERLPL
TAAPLRFASWMGGDRDGNPNVTASVTREVLLLARWMAADLYLRDIDRLAAELSMQQASPQ
LLARVGDSAEPYRALLKQLRERLRVTRNWTHQALAGEVPAAEGVLEHNRDLVEPLQLCHE
SLHACGMGVIADGALLDCLRRAATFGLFLVRLDVRQDSARHAAALSEITEYLELGSYDEW
DEKTRLEFLLEELNSRRPLLPAHYQPSADTAEVLATCRAIAAAPPASLGSYVISMAGQPS
DVLAVQLLLKESGVDWPMRVVPLFETLDDLDNAGPCMERLLTLPGYRSRLSGVQEVMIGY
SDSAKDAGTLTAAWAQYRAQEKLVEICRQHEVELLLFHGRGGTVGRGGGPAHAAILSQPP
GSVAGRFRVTEQGEMIRFKFGLPDIAEQNLNLYLAAVLEATLMPPPAPEPAWRAQMDRLA
KDALLAYRRVVRDDPQFVEYFRLATPEQELGRLPLGSRPAKRREGGVESLRAIPWIFAWT
QTRLMLPAWLGWETALLNAIERGEGALLGQMREQWPFFTTRIDMLEMVLAKADADIARLY
DERLVPLELRPLGRRLRDLLSQAVRVVLGLTGQSLLLAHASETRESISVRNSYLDPLHLL
QAELLARSRRCRGDACGGLEQALLVTVAGVAAGLRNTG
NT seq 2637 nt NT seq  +upstreamnt  +downstreamnt
atgccggaaatcgatgcgcgcctgcgcgaggacgtccaccaactgggcgaattgctcggc
gacaccatccgcgagcagtacggcccgcggttcctcgacaagatcgagctgatccgcaag
ggcgccaaggctgcccgccgcggttccgcggagggcgcccagcagctcaccgccaccctc
gacgggctcgaggaagacgaactgctgccggtggcgcgggccttcaaccagttcctcaac
ctggccaatatcgccgagcaataccaccgtatccgccggcgccggccgaacgagccggaa
cccttcgagaacctggtgctggaagagctgctggggcgtctcaaggacgccgggcatgcc
cccgggcaactggctcgccagctcgccgggctggagatcgaactggtgctgaccgcccat
cccaccgaggtggcgcggcgcacgctgatccagaaatacgatgcgatcaccgcgcaactg
gcggccaaggaccatgccgacctgctgccggaggagcgcagtcgcatccagcagcgcctg
cagcggctggtggccgaggcctggcataccgacgagatccgcaaggtccggccgaccccg
gtggacgaggcgaaatggggcttcgcggtgatcgaacattctctctggcaggccttgccg
aacgtccttcggcacgtcgacgaggtactcctgcgcagcaccggcgaacgcctgccgttg
accgccgcgccgctgcgcttcgcgtcctggatggggggcgaccgcgacggcaatcccaac
gtcaccgccagcgtgacccgcgaggtcctgctgctggcgcgctggatggccgccgacctg
tacctgcgcgatatcgaccgactggccgccgagctgtccatgcagcaggcctcgccgcag
ctgctggcgcgggtcggcgatagcgccgagccctatcgcgccctgctcaagcaattgcgc
gagcgcctgcgcgtgacccgcaactggacccaccaggccctggccggcgaggtgccggcc
gcggagggcgtcctggagcacaaccgcgacctggtcgagccgctgcaactgtgccacgag
tcgctgcacgcctgcggcatgggcgtgatcgccgatggcgcgttgctcgactgcctgcgc
cgcgccgccaccttcggcctgttcctggtacgcctggacgtgcgccaggactcggcccgc
catgccgccgcgctgagcgagatcaccgagtacctggagctgggcagctacgacgagtgg
gacgagaagacccgcctggaattccttctcgaggaactgaacagccgccgccccctgctg
ccggcgcactaccagccttcggcggataccgccgaggtgctcgccacctgccgggcgatc
gccgccgcaccaccggcgtcgctggggtcctacgtgatctcgatggccggccagccgtcc
gacgtgctggcggtgcaactgctgctaaaggaaagcggcgtcgactggccgatgcgcgtg
gtgccgctgttcgagaccctcgacgacctggacaacgccggcccctgcatggagcgcctg
ctgacgctgccgggctaccgttcgcggctgtccggggtgcaggaagtgatgatcggctac
tccgattcggccaaggacgccggtaccctcacggcggcctgggcgcagtaccgggcgcag
gagaaactggtggagatctgccgccagcacgaggtcgagttgctgctcttccacggccgc
ggcggtaccgtcggtcgcggcggcgggccggcccacgcggcgatcctgtcgcagccgccg
ggttcggtggccgggcgcttccgggtcaccgaacagggcgagatgatccgcttcaagttc
ggtctgccggacatcgccgaacagaacctcaatctctacctcgccgcagtgctggaagcg
accctgatgccgccgccggctccggagccggcctggcgcgcgcagatggaccgcctggcg
aaggacgcgctgctggcctaccgcagggtggtgcgcgacgatccgcagttcgtcgagtat
ttccgcctggccacgcccgagcaggaactgggccgtctgccgctgggcagccgcccggcc
aagcgccgcgaaggcggggtggagagcctgcgggcgattccctggatcttcgcctggacc
cagacgcgcctgatgctgccggcatggcttggctgggagaccgccttgctgaacgccatc
gagcgtggcgagggcgcgctgctcgggcagatgcgcgagcaatggccgttcttcaccacc
cgcatcgacatgctggaaatggtcctggccaaggccgacgcggatatcgcgcggctctac
gacgaacgtctagtgccgctcgagctgcgtccgctggggcgtcgtttacgcgacctattg
tcgcaggcggtgcgcgtggtgctgggactgaccgggcagtcgctgctgctcgcccacgcc
agcgagacccgcgagtcgatcagcgtgcgcaacagctatctagacccgctgcacctgctc
caggctgagcttctggcccgttcgcggcgctgccggggcgacgcctgcggcggcctggag
caggcgctgctggtgacggtcgcgggggtcgccgccggactgcgcaacaccggatga

DBGET integrated database retrieval system