KEGG   Pseudomonas aeruginosa PAO581: M801_4106Help
Entry
M801_4106         CDS       T03171                                 

Definition
(GenBank) hypothetical protein
Organism
paeo  Pseudomonas aeruginosa PAO581
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AGV58084
LinkDB All DBs
Position
4372335..4372556
Genome map
AA seq 73 aa AA seqDB search
MLESEIVAARRAYAASLGVTLSGAISNADEPVHIRHAVSNSNHNPNASNRINLGRARAYK
KRREEGDYFFIDT
NT seq 222 nt NT seq  +upstreamnt  +downstreamnt
atgctcgagagcgagatcgttgcggcacgccgggcctatgccgccagcctgggagtgacg
cttagcggagcgatcagcaacgccgacgagccggtccatatccgccacgccgtcagcaat
tccaatcacaaccccaacgcctcaaaccgtatcaaccttgggagggcccgagcgtataaa
aaaaggcgcgaggaaggtgattacttcttcatcgacacttga

DBGET integrated database retrieval system