KEGG   Pseudomonas aeruginosa PAO581: M801_4126Help
Entry
M801_4126         CDS       T03171                                 

Gene name
hpaI
Definition
(GenBank) 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase
  KO
K02510  4-hydroxy-2-oxoheptanedioate aldolase [EC:4.1.2.52]
Organism
paeo  Pseudomonas aeruginosa PAO581
Pathway
paeo00350  Tyrosine metabolism
paeo01100  Metabolic pathways
paeo01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:paeo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    M801_4126 (hpaI)
Enzymes [BR:paeo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.52  4-hydroxy-2-oxoheptanedioate aldolase
     M801_4126 (hpaI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HpcH_HpaI PK DUF2156
Motif
Other DBs
NCBI-ProteinID: AGV57965
LinkDB All DBs
Position
4395745..4396551
Genome map
AA seq 268 aa AA seqDB search
MDLPVNRFKQRLRSGEAQIGLWLGLADPYCAELAANAGFDWLLLDGEHAPNDLRSLLGQL
QALAPYPGQPVIRPVQGDTALIKQLLDIGAQTLLVPMVDSAAQAEGLVRAVRYPPAGVRG
VGSALARASRWNSVAEYLNHADEQMCLLVQVENLEGLANLDAIAAVEGVDGVFIGPADLS
AAMGHRGNPGHPEVQAAIEDAIHRIRTAGKAAGILSADETLARRYLELGCAFVAVGVDTS
LLMRSLRELAGRFKGGAPAPSASSSVYG
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atggacctgcccgtcaatcgcttcaagcaacgcctgcgcagcggcgaggcgcagatcggc
ctgtggctcggcctggccgatccctactgcgcggagctggccgccaacgccggcttcgac
tggctgctgctggacggcgagcacgcgcccaacgacctgcgcagcctgctcggccagttg
caggcgctggcgccctaccccggccagccggtgatccgcccggtgcagggcgacactgcg
ctgatcaagcaattgctcgacatcggcgcgcagaccctgctggtaccgatggtcgacagc
gccgcccaggccgaagggctggtgcgcgccgtgcgctatccgccggcgggcgtacgcggg
gtcggcagtgcgctggcccgggcctcgcgctggaacagcgtggcggagtacctgaaccac
gccgacgagcagatgtgcctgctggtccaggtggaaaacctggagggcctggccaacctc
gacgcgatcgccgccgtcgagggcgtcgacggcgtgttcatcggtccggccgacctcagc
gcagccatgggccatcgcggcaatccaggccatcccgaggtgcaggcggccatagaggac
gccatccaccgcatccgcacggccggcaaggccgccggcatcctctccgccgacgagaca
ctggcgcggcgctacctggagctgggctgcgcgttcgtcgcggtgggcgtggacaccagc
ctgctgatgcgttcgctgcgcgagctggcggggcgcttcaagggcggcgcgccggcgccg
tccgccagttcctcggtctacggctga

DBGET integrated database retrieval system