KEGG   Pseudomonas aeruginosa PAO581: M801_4151Help
Entry
M801_4151         CDS       T03171                                 

Definition
(GenBank) zinc-binding dehydrogenase family protein
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
paeo  Pseudomonas aeruginosa PAO581
Pathway
paeo00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:paeo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    M801_4151
Enzymes [BR:paeo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     M801_4151
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     M801_4151
    1.1.1.-  
     M801_4151
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_N_assoc ADH_zinc_N_2 AlaDh_PNT_C 2-Hacid_dh_C DAO Pyr_redox_2 UDPG_MGDP_dh_N NAD_binding_7
Motif
Other DBs
NCBI-ProteinID: AGV62836
LinkDB All DBs
Position
4426333..4427394
Genome map
AA seq 353 aa AA seqDB search
MRAAVWHGRHDIRVEDVPLPAEPPPGWVQIRVHWCGICGSDLHEYLAGPVFIPVEAPHPL
TGLKDQCILGHEFSGEIVRLGNGVTGFAVGQAVAADACQHCGTCYYCRHGLYNICENLAF
TGLMNNGAFAEYVNVPANLLYALPAGFPSEAGALIEPLAVGMHAVKKAGSLLGQNVVVVG
AGTIGLSTIMCARAAGAAQVIALEMSSARKAKALEVGASQVLDPSRCDALGEIRALTGGL
GADVSFECIGNKHTAKLAIDAIRKAGKCVLVGIFEEPSEFNFFELVSTEKQLLGALAYNG
EFADVIAFIADGRLDIAPLVTGRIGLEEIVERGFEELVNNKEHNVKIIVSPGG
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgccgccgtctggcacggccgccacgatatccgcgtggaagacgtgccgctcccg
gccgagccgccgcccggctgggtgcagatccgcgtgcactggtgcggcatctgcggctcc
gacctgcacgaatacctggccggcccggtattcatccccgtggaggcgccgcacccgctc
accggcctcaaggatcaatgcatcctcggccacgagttcagcggcgaaatcgtccgcctc
ggcaacggcgtgaccggcttcgccgtcggccaggcggtcgccgcagacgcctgccagcat
tgcggcacctgctactactgccggcatgggctgtacaacatctgcgagaacctggccttc
accgggctgatgaacaacggcgccttcgccgaatacgtcaacgtaccggccaacctgctc
tacgccctgccggccggatttcccagcgaggccggcgcgctgatcgagccgctggcggtg
ggcatgcacgcggtgaagaaggccggcagcctgctcgggcagaacgtggtggtggtcggc
gccggcaccatcggcctgagcaccatcatgtgcgcgcgcgccgccggcgcggcacaggtg
atcgccctggagatgtcctcggcgcgcaaggccaaggccctggaggtcggcgccagccag
gtgctcgacccctcgcggtgcgacgccctaggcgaaatccgcgccctcaccggcgggctt
ggcgccgacgtcagcttcgaatgcatcggcaacaagcacaccgccaagctggccatcgat
gccatccgcaaggccggcaaatgcgtgcttgtgggaatcttcgaggagcccagtgaattc
aatttcttcgagctggtttccaccgagaagcagttgctcggggccctcgcctacaacggc
gagttcgccgacgtgatcgccttcatagccgacggccgcctcgacatcgcaccgctggtg
accggtcgcatcggcctggaagaaatcgtcgagcgcggtttcgaagagttggtgaacaac
aaggagcacaacgtgaagatcatcgtctcgccgggcggctga

DBGET integrated database retrieval system