KEGG   Pseudomonas aeruginosa PAO581: M801_4420Help
Entry
M801_4420         CDS       T03171                                 

Gene name
ddl
Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
paeo  Pseudomonas aeruginosa PAO581
Pathway
paeo00473  D-Alanine metabolism
paeo00550  Peptidoglycan biosynthesis
paeo01100  Metabolic pathways
paeo01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:paeo00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    M801_4420 (ddl)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    M801_4420 (ddl)
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    M801_4420 (ddl)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:paeo01011]
    M801_4420 (ddl)
Enzymes [BR:paeo01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     M801_4420 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:paeo01011]
 Precursor biosynthesis
  Amino acid ligase
   M801_4420 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp ATP-grasp_4 ATPgrasp_Ter ATP-grasp_3 ATPgrasp_YheCD RimK ATP-grasp_5 GARS_A TTL
Motif
Other DBs
NCBI-ProteinID: AGV61632
LinkDB All DBs
Position
complement(4722261..4723220)
Genome map
AA seq 319 aa AA seqDB search
MNLCLDSLLNGTQDPKAFGRVAVLFGGKSAEREVSLKSGAMVLQSLLAAGVDAFGIDVGE
DLLQRLVEEKIDRAFIILHGRGGEDGSMQGLLECAGIPYTGSGVLASALAMDKLRTKRVW
LSLGLPTPDYAVLASEDDCREAAQRLGFPLIVKPAHEGSSIGMAKVGGLDELIAAWREAA
RYDSQVLVEQWISGPEFTVATLRGQVLPAIRLGTPHTFYDYDAKYLASDTRYQVPCGLDE
AKERELKELTARACDALGIQGWGRADVMQDAEGRFWLLEVNTAPGMTDHSLVPMAARAAG
LDFQQLVLAILADSREARG
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaacctttgcctcgatagcctgctgaacggcacccaggatcccaaggcgttcggccgt
gtcgccgtgctgttcggcggcaagagcgccgagcgcgaggtgtcgctgaagtccggcgcg
atggtcctgcaatccctgctggccgccggggtcgatgccttcggcatcgatgtcggcgaa
gacctgctgcaacgcctggtcgaggagaagatcgaccgtgccttcatcattctccacggt
cgtggcggcgaggatggcagcatgcagggcctgctcgagtgcgcgggcattccctacacc
ggcagcggcgtgctggcctcggcgctggcgatggacaagctgcggaccaagcgggtctgg
ctcagcctcggcctgccgaccccggactacgcggtgctggccagcgaggatgactgccgc
gaagcggcgcagcgactgggtttcccgctgatcgtcaagccggctcacgaaggctcgagc
atcggcatggccaaggtcggcgggctcgacgaattgatcgcggcgtggcgcgaagcggcc
cgctacgactcgcaggtgctggtcgagcagtggatcagcggcccggaattcaccgtggcg
accttgcgcgggcaggtgctgccggcgatccgcctgggcacgccgcacaccttctacgac
tacgacgccaagtacctggccagcgatacccgctaccaggtgccctgcggtctcgacgag
gccaaggaacgcgagctgaaggaactcaccgcgcgcgcctgcgacgccctgggcatccag
ggctgggggcgggcggacgtgatgcaggacgccgaagggcgtttctggctgcttgaagtc
aacaccgcaccgggcatgaccgaccacagcctggtgcctatggccgcgcgggccgccggc
ctggatttccagcaactggtgctggcgatcctggccgatagccgcgaggcgaggggataa

DBGET integrated database retrieval system