KEGG   Pseudomonas aeruginosa PA1: PA1S_00410Help
Entry
PA1S_00410        CDS       T02928                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K11912  serine/threonine-protein kinase PpkA [EC:2.7.11.1]
Organism
paep  Pseudomonas aeruginosa PA1
Pathway
paep02025  Biofilm formation - Pseudomonas aeruginosa
paep03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:paep00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    PA1S_00410
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02025 Biofilm formation - Pseudomonas aeruginosa
    PA1S_00410
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:paep01001]
    PA1S_00410
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:paep02044]
    PA1S_00410
Enzymes [BR:paep01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     PA1S_00410
Protein kinases [BR:paep01001]
 Serine/threonine kinases: Other
  Bacterial family
   PA1S_00410
Secretion system [BR:paep02044]
 Type VI secretion system
  Imp/Vas secretion system related proteins
   PA1S_00410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr TssR VWA APH VWA_2 Pkinase_fungal Kinase-like Kdo
Motif
Other DBs
NCBI-ProteinID: AHA19508
LinkDB All DBs
Position
complement(96473..99571)
Genome map
AA seq 1032 aa AA seqDB search
MDIELPGFDIERELGEGAMATVYLATQRSLQRKVALKVMAAALAADPSFAERFLREGRTL
ARLSHPNTVTIHDIGNVGSCYYMAMEYLPNGTLKERIQQGLDPEQGLAYVRQVAAALGYA
HSQGLVHRDVKPANILFRADGTAVLSDFGIAKSIEDNTQFTQVGFAVGTPSYMSPEQARG
QEIDGRADLYALGVVLYEILTGKLPYNGKDSLSTALAHLTEPLPELPIEQGRYQDILRQL
LAKDPAERFPTAGALIAALDRLAPSALEATQIRPLATPQGSPRASNPPPAEPAPLPPADL
GGLQPVSIQLPPVTPSAGGATPPPPPPSQAAKPPSPPPPPLPPAKPRAGGSRTPLIAAAA
AAVLLAIGGGAWWLLGSGDAPSAADPAPLGQTPADKPQQQTPVADAEQDGGERPLLMPGK
KTLFQRVLTKPGAAISAEAGGPPRAGAVPAFSVLYVYARKQVGGSPWLRVGASSNGEGDG
WLPASAVSDWKQSLVLKFTERSGRAPVMFLNSAEQVERLLGDTRAARDTLTQAVDHKGDP
QVVAVEPNDRAIPQDQFYLLPIFDSKESFDADGQPAQLLEVASIDPGGSATAPQAPGQAG
RGGASGAASDTFRTGIVLVVDTSVSMQPYIDRVREVIDGLQRQIGERGDLDKVSFGLVGF
RNNTDKTPGLEYVSKTLVPLQPGNDAQRFAELSSQVRATDVSSHSFNEDAFAGIMQAVDE
MDWSPYAGRVVLLVTDAGALRKNDPLGRTQMNEAEVRQAALRKGVKIYALHLRTPAGKNN
HGYAEQQYRSLTADANPKIADLYIPVAGGEVNAFGNTVKEIGTVFADLVHDAGNRKPQAP
RFDAAPSVASKSAAIGYAMQMEFLGRRDPVRAPQVVTAWTADRDLTNPALPAFQVCVLLS
KLQLNELQQSLKLIVDAAKRTQTSPKDFFQEIASASAYMSRDPAQLVKGSNLAQSGVLGE
YLEGLPYRSKSLNMTQDLWLSLSVAEQQDFIDELESKIRLYETFHNDVANWVRFGDADAG
DALYRVPLSTLP
NT seq 3099 nt NT seq  +upstreamnt  +downstreamnt
atggacatagaacttccgggattcgacatcgaacgcgagctgggcgaaggcgccatggcc
acggtctacctggccacccagcgctcgctgcagcgcaaggtggcgctgaaggtgatggcc
gcggcgctggccgccgacccgagcttcgccgaacgcttcctgcgcgaaggtcggaccctg
gcgcggctgtcgcacccgaacacggtgaccatccacgacatcggcaacgtcggcagttgc
tactacatggccatggaatacctgcccaacggcacgctcaaggagcgcatccagcagggc
ctcgatcccgagcagggcctggcctacgtacggcaggtggccgccgcgctcggctacgcg
cactcccagggcctggtgcatcgcgacgtgaagccggccaacatcctgttccgcgccgac
ggcaccgcggtgctctcggacttcggcatcgccaagtcgatcgaggacaatacccagttc
acccaggtcggcttcgccgtcggcacccccagctacatgagcccggagcaggcccgcggg
caggagatcgacggccgcgccgacctctacgcgctgggcgtggtgctctacgagatcctc
accggcaagctgccctacaacggcaaggactcgctctccaccgccctggcccacctcacc
gagccgctgccggaactgccgatcgagcagggccgctaccaggacatcctgcgccagttg
ctggccaaggacccggccgagcgcttccccaccgccggcgcgttgatcgccgccctcgac
cgcctggcgccgagcgccctggaagccacccagatccgtccgctggcgacgccgcagggc
tcgccgcgagcgagcaacccgccgccggccgaacccgcgcccctgccgcccgccgacctc
ggcggcctgcaaccggtgtcgatccagttgccgccggtcacgcccagcgccggcggcgcc
acgccgcctccgcctccgccgtcgcaagcggcgaaaccgccatcgcccccgccgcctccg
ttgccgccggcgaagccacgtgccggcggcagccgcacgccgttgatcgccgccgccgcg
gccgccgtgctcctggcgatcggcggcggcgcctggtggctgctgggctcgggcgacgcg
ccgagcgctgccgatccagcgccgctgggacagacgccggcggacaagccgcagcagcag
accccggtggccgatgccgaacaggacggcggcgagcgtccgctgctgatgccaggcaag
aagacgctgttccagcgcgtcctgaccaaacccggcgcggccatctccgccgaggctggc
ggcccgccccgggccggcgcggtgccggccttctcggtgctctacgtgtacgcccgcaag
caggtcggcggcagcccctggctgcgcgtcggcgcctccagcaacggcgagggcgacggc
tggctgccggccagcgcggtgagcgactggaagcagagcctggtgctgaagttcaccgaa
cgctccggccgcgcgccggtgatgttcctcaacagcgccgagcaggtcgaacgcctgctc
ggcgatacccgcgcggcgcgcgacaccctgacccaggcggtggaccacaagggcgatccg
caggtggtcgcggtcgagcccaacgaccgggcgatcccccaggaccagttctacctgctg
ccgatcttcgactcgaaggagagcttcgacgccgacggccagccggcgcagttgctggag
gtcgcttcgatcgaccccggcggcagcgccacggcaccccaggcgccgggccaggccggg
cggggcggcgccagcggcgcggcgagcgacaccttccgcaccggcatcgtcctggtggtg
gacacctcggtgtcgatgcagccctacatcgaccgcgtgcgcgaggtgatcgacggcctg
cagcggcagatcggcgagcgcggcgacctggacaaggtcagcttcggcctggtcggcttc
cgcaacaacaccgacaagacccccggcctggaatacgtcagcaagaccctggtgccgctg
caaccgggcaacgacgcgcagcgcttcgccgagttgagcagccaggtgcgcgccaccgac
gtctccagccactcgttcaacgaagacgccttcgccgggatcatgcaggcggtcgacgaa
atggactggtcgccctacgccgggcgcgtggtgctgctggtcaccgacgccggcgcgctg
cgcaagaacgacccgctcgggcgtacccagatgaacgaggccgaggtccgccaggcggcg
ctgcgcaagggcgtgaagatctatgccctgcacctgcgcaccccggccgggaagaacaac
cacggctacgccgagcagcagtaccgcagcctcaccgccgacgccaacccgaagatcgcc
gacctctacatcccggtggccggcggcgaggtgaacgccttcggcaacacggtgaaggag
atcggcacggtgttcgccgacctggtccacgacgccggcaaccgcaagccgcaggcgccg
cgcttcgacgccgcgccaagcgtggcgagcaagtcggcggccatcggctacgccatgcag
atggaattcctcggtcgccgcgacccggtgcgcgcgccgcaggtcgtcaccgcctggacc
gccgaccgcgacctgaccaacccggcgctgccggcgttccaggtctgcgtgctgctgagc
aagctgcaactcaacgaactgcaacagtcgctgaaactgatcgtcgacgcggccaagcgc
acccagacctcgcccaaggacttcttccaggaaatcgccagcgccagcgcctacatgagc
cgcgacccggcgcaactggtgaagggcagcaacctggcgcagagcggcgtgctcggcgaa
tacctggaaggcctgccgtaccgcagcaagtcgctgaacatgacccaggacctctggctg
tcgctgagcgtcgccgaacagcaggacttcatcgacgaactggagtcgaagatccgcctc
tacgaaaccttccacaacgacgtcgccaactgggtccggttcggcgacgccgacgccggc
gacgcgctgtatcgcgtgccgctgtcgacgctgccatga

DBGET integrated database retrieval system