KEGG   Pseudomonas aeruginosa PA1: PA1S_00740Help
Entry
PA1S_00740        CDS       T02928                                 

Definition
(GenBank) alkyl hydroperoxide reductase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
paep  Pseudomonas aeruginosa PA1
Brite
KEGG Orthology (KO) [BR:paep00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    PA1S_00740
Enzymes [BR:paep01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     PA1S_00740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 HI0933_like FAD_binding_2 FAD_oxidored AlaDh_PNT_C DAO FAD_binding_3 K_oxygenase Glutaredoxin NAD_binding_7 Thi4 FMO-like NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: AHA19574
LinkDB All DBs
Position
168146..169711
Genome map
AA seq 521 aa AA seqDB search
MLDANLKTQLKAYLEKVSQPFEIVASLDDSDKSRELLGLLQDIVGLTDKITLKTDGSDAR
KPSFSLNRPGADIGLRFAGIPMGHEFTSLVLALLQVGGHPSKLDADVIEQVKGIEGTFEF
ETYFSLSCQNCPDVVQALNLMAVLNPNIRHVAIDGALFQDEVEARQIMSVPSIYLNGEVF
GQGRMGVEEILAKIDTGAAARDAEKLTARDAFDVLVVGGGPAGAAAAIYAARKGIRTGVA
AERFGGQVLDTMAIENFISVQETEGPKLARALEEHVRHYEVDIMNLQRASKLVPAKNTGE
LHEVQFESGGSLKAKTLVLATGARWREMGVPGEQEYKAKGVCFCPHCDGPLFKGKRVAVI
GGGNSGVEAAIDLAGIVAHVTLLEFDSKLRADAVLQRKLYSLPNVEVITSALTSEVKGDG
QKVTGLVYKDRNSEEFKSIELEGIFVQIGLLPNTEWLKGSVELSPRGEIIVDARGETSLP
GIFAAGDVTTVPYKQIVIAVGEGAKASLSAFDHLIRTSAPE
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgttggacgccaatcttaaaacccagttgaaggcctacctggaaaaggtcagccagccg
ttcgagatcgtcgcgtccctcgatgacagcgacaaatcccgcgagctgctgggcctgctg
caagacatcgtcggcctgaccgacaagatcaccctgaagaccgacggcagcgatgcgcgc
aaaccgtcgttctcgctgaaccgccccggtgcggacatcggcctgcgcttcgccggtatc
cccatgggccacgaattcacctcgctggtgctggccctgctgcaggtaggcggccacccc
tccaagctcgacgcggacgtgatcgagcaggtcaagggcatcgagggcaccttcgagttc
gaaacctacttctcgctgtcctgccagaactgcccggacgtggtccaggcgctgaacctg
atggccgtgctcaacccgaacatccgtcacgtcgccatcgacggcgcgctgttccaggat
gaggtcgaggcgcgccagatcatgtcggtgccgagcatctacctcaacggcgaagtcttc
ggccagggccgcatgggcgtggaagagatcctcgccaagatcgacaccggcgccgccgcc
cgcgacgccgagaagctgaccgcccgcgacgccttcgacgtgctggtggtcggcggtggc
ccggccggagccgcggcggcgatctacgccgcgcgcaagggcattcgcaccggcgtcgcc
gccgagcgcttcggcggccaggtgctggacaccatggccatcgagaacttcatctcggtg
caggagaccgaagggccgaagctggcgcgggcgctggaagagcacgtgcgtcactacgag
gtcgacatcatgaacctgcagcgcgccagcaagctggttccggcgaagaacaccggcgag
ttgcacgaggtgcagttcgagagcggcggcagcctcaaggccaagaccctggtcctcgcc
accggcgctcgctggcgcgaaatgggcgtgcccggcgagcaggaatacaaggccaagggc
gtgtgcttctgcccgcactgcgatggcccgctgttcaagggcaagcgcgtggcggtgatc
ggcggcggcaactctggcgtcgaggcggccatcgacctggccggcatcgtcgcccacgtg
accctgctggaattcgacagcaagttgcgcgccgacgccgtgctgcaacgcaagctctac
agcctgccgaacgtcgaggtgatcaccagtgccctgaccagcgaagtgaagggcgacggc
cagaaggtcaccggcctggtgtacaaggaccgcaactccgaggagttcaagtcgatcgag
ctggaaggtatcttcgtgcagatcggcctgctgcccaacaccgagtggctcaagggcagc
gtcgagctgtcgccgcgcggcgagatcatcgtcgacgcccgtggcgagacctcgctgccc
ggcatcttcgccgccggcgacgtgaccacggtgccgtacaagcagatcgtgatcgccgtg
ggcgagggcgccaaggcttcgctgagcgccttcgaccacctgatccggacctccgcgccg
gagtga

DBGET integrated database retrieval system