KEGG   Pseudomonas aeruginosa PA1: PA1S_01110
Entry
PA1S_01110        CDS       T02928                                 

Definition
(GenBank) malonate transporter
Organism
paep  Pseudomonas aeruginosa PA1
SSDB
Motif
Pfam: MadL FliP ATPase_gene1
Other DBs
NCBI-ProteinID: AHA19649
LinkDB
Position
250516..250920
AA seq 134 aa
MIIYGVALLSLCTLAGLFIGEILGVMLGVPANVGGVGIAMLLLIFVGSYLGKRGLLSAKT
EQGVEFWSAVYIPIVVAMAAQQNVLGALSGGPAAILAGIAAVAVAFALVPLLDRFGRKKA
EGAPPLKPRTSVQG
NT seq 405 nt   +upstreamnt  +downstreamnt
atgattatctacggtgtcgcactgctgtctctgtgtaccctcgccgggctgttcatcggc
gagatccttggcgtgatgctcggcgtgccggccaacgtcggtggcgtcggcatcgccatg
ctgctgctgatcttcgtcggcagctacctgggcaagcgtggcctgctctcggcgaagacc
gagcagggcgtggagttctggagcgcggtctacattcccatcgtggtcgccatggccgcc
cagcagaatgtcctcggcgcgctgagcggcgggccggccgctatcctcgccggcatcgcc
gcggtcgccgtggccttcgccctggtcccgctgctcgaccgcttcggccggaagaaagcc
gaaggcgccccgccattgaaaccgcgcaccagcgtgcaggggtga

DBGET integrated database retrieval system