KEGG   Pseudomonas aeruginosa PA1: PA1S_04275Help
Entry
PA1S_04275        CDS       T02928                                 

Definition
(GenBank) LysR family transcriptional regulator
  KO
K17850  LysR family transcriptional regulator, regulator of gene expression of beta-lactamase
Organism
paep  Pseudomonas aeruginosa PA1
Pathway
paep01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:paep00001]
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    PA1S_04275
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:paep03000]
    PA1S_04275
Transcription factors [BR:paep03000]
 Prokaryotic Type
  Helix-turn-helix
   LysR family
    PA1S_04275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LysR_substrate HTH_1
Motif
Other DBs
NCBI-ProteinID: AHA17953
LinkDB All DBs
Structure
PDB: 

Position
918856..919746
Genome map
AA seq 296 aa AA seqDB search
MVRPHLPLNALRAFEASARHLSFTRAAIELCVTQAAVSHQVKSLEERLGVALFKRLPRGL
MLTHEGESLLPVLCDSFDRIAGLLERFEGGHYRDVLTVGAVGTFTVGWLLPRLEDFQARH
PFIDLRLSTHNNRVDIAAEGLDYAIRFGGGAWHGTEALALFEAPLTVLCCPEVAAQLHSP
ADLLQHTLLRSYRADEWPLWFQAAGLPAHAPLTRSIVFDTSLAMLEAARQGVGVALAPAA
MFARQLASESIRRPFATEVSTGSYWLTRLQSRGETSAMLAFRGWLLEMAAVEARGR
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
ttggttcgaccccatttgccgctgaacgccctgcgcgccttcgaagcttcggcccggcac
ctgagcttcacccgcgcggccatcgagctgtgcgtgacccaggcggcggtcagccaccag
gtgaagagcctcgaggagcgtctcggcgtggccctgttcaagcgtctgccgcgcggcctc
atgctgacccacgagggcgagagcctgctgccggtgctgtgtgactccttcgaccgcatc
gccggcctgctggaacgtttcgagggtggccactaccgggacgtgctcaccgtcggcgcg
gtcggaaccttcacggtcggttggctgctgccgcggctggaggacttccaggcgcgccat
cccttcatcgatctgcgcctgtccacccacaacaaccgcgtcgacatcgccgccgagggg
ctcgactacgcgatccgcttcggcggcggcgcctggcacggcaccgaggcgctggcgttg
ttcgaggcgccgctgacggtgctctgctgccccgaggtcgccgcccagttgcacagtccc
gccgacctgctgcagcacaccctgctgcgctcctaccgcgccgacgagtggccgctgtgg
ttccaggcggccggactgccggcgcacgcgccactgacccggagcatcgtcttcgacacc
tcgctggccatgctcgaggcggcccgccagggtgtcggcgtggccctggcgccggcggcg
atgtttgcccggcaactggccagcgagagcatccggcgtccgttcgccaccgaagtgagt
accggcagctactggctgacgcgcttgcagtcgcggggggagaccagcgcgatgctggcg
ttccgggggtggttgctggagatggctgccgttgaggcgcgggggagataa

DBGET integrated database retrieval system