KEGG   Pseudomonas aeruginosa PA1: PA1S_04350Help
Entry
PA1S_04350        CDS       T02928                                 

Definition
(GenBank) MFS transporter
Organism
paep  Pseudomonas aeruginosa PA1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 Sugar_tr MFS_1_like Nuc_H_symport LacY_symp
Motif
Other DBs
NCBI-ProteinID: AHA17938
LinkDB All DBs
Position
complement(933223..934482)
Genome map
AA seq 419 aa AA seqDB search
MAHNNNSASYENVLLCVLFLTFGFVFFDRLALSFLFPFMEQELQLSNSHLGMLSSVLALA
WAVSGALVGAWSDRRGQRKPLLIVAVILFSLCSALSGLVGGFLSLLLFRGIMGLAEGPIL
PLSQSLMVEASSPHRRGLNMGLLQGSAAGLLGAVIGPPLLVALAETLGWRHAFIVSLLPG
LLIAWLIWRHVRPDPPRAQRPAPRAEEAKGKRLALLKSRNILLCTLISCVFVTWFIVLIS
FTPTFLVNARGFSPATMGRLMSCLGVAWVVWGFAVPAISDRIGRRPTLVAFSLLAACCPL
ALLYAPNATSLGLLLLLTYTGLGCFTLFMATIPAETVSRGVIATALGLIMGLGELVGGFL
APTVAGFAADRFGLSIVMWMSCGGALLAAFLSLFLRETAPAVLARQRSAPTSVLQGNQP
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atggcgcataacaacaattccgccagttacgaaaacgtcctgctctgcgtgctgttcctg
accttcggcttcgtcttcttcgaccgcctggcgctgtccttcctgtttcccttcatggaa
caggagctgcaactgagcaacagccacctgggcatgctctcctcggtgctggccctggcc
tgggcggtatccggcgcgctggtcggcgcctggtccgaccgccgcgggcagcgcaagccg
ctgctgatcgtggcggtgatcctgttctcgctgtgctcggcgctgtccgggctggtcggc
ggcttcctcagcctgctgctgttccgcggcatcatgggcctggccgaggggccgatcctg
ccgctctcgcaatcgctgatggtcgaggcctcctcgccacatcgccgcggcctcaacatg
ggtctgctacagggctcggcggccggcctgctcggcgcggtgatcggcccgccgctgctg
gtggccctggccgaaaccctcggctggcgtcacgccttcatcgtctcgttgctgccgggc
ctgctgatcgcctggttgatctggcgccatgtgcgtcccgacccgccccgcgcgcagcgc
ccggcgccgcgcgcagaagaagcgaaaggcaagcgcctggcactgctgaagagccgcaac
atcctgctctgcaccctgatcagttgcgtattcgtcacctggttcatcgtgctgatttcc
tttaccccgaccttcctggtcaacgcccgcggcttcagcccggcgaccatgggcaggctg
atgagctgcctgggcgtcgcctgggtggtctggggcttcgccgtaccggcgatatccgat
cgcatcggccgtcgaccgaccctggtggcgttctccctgctcgccgcgtgttgcccgctg
gcgctgctctatgcgccgaacgcgaccagcctcggcctgctgttgctgctgacctacacc
gggctcggctgcttcaccctgttcatggcgaccatcccggcggagaccgtctcgcgcggc
gtcatcgccaccgccctcggcctgatcatgggcctcggcgaactggtcggcggtttcctc
gcgccgaccgtggccggcttcgccgccgaccgcttcggcctgtccatcgtcatgtggatg
tcctgcggcggcgccctgctcgccgcgttcctctcgctgttcctgcgcgaaaccgcgccc
gccgtgctggcgcgccagcgcagcgcgcctacctccgtcctgcaaggaaaccaaccatga

DBGET integrated database retrieval system