KEGG   Pseudomonas aeruginosa PA1: PA1S_04360Help
Entry
PA1S_04360        CDS       T02928                                 

Definition
(GenBank) AraC family transcriptional regulator
Organism
paep  Pseudomonas aeruginosa PA1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_18 HTH_AraC AraC_binding_2 AraC_binding
Motif
Other DBs
NCBI-ProteinID: AHA17936
LinkDB All DBs
Position
935405..936364
Genome map
AA seq 319 aa AA seqDB search
MPAHALLETRRASTQDIPLEQRLAFWEDYNASILVGLKCSSYSQAGFAATQDNLCLERLR
LARIGGNEHVVERDRSMIRAVPKESIFVSLVQGSQSFFYQDNGCNLLQPGELVIYRTDKP
YLFGFSGPMRQFIFDIPQDDFAERCLRDFKGPLKIGAESPVQRLLVRTLGERTRDFLDSP
HGEDAERYQEEAYDLLASIISDHAGEHRASALGASYLLAAKQYIQQHLDEPALSCERVAA
ATGVSSRHLARLFAQEGSSPGRYLQERRLERARQLLASPQGRRLDVAEVAYRHGFSSQAH
FARAFKARYGMTPSEARGR
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgcccgcacatgccttgctcgaaacccggcgggccagcacccaggacattcccctggag
cagcggctggcgttctgggaggactacaacgcttccatcctggttggcctgaaatgttcg
tcgtattcccaggccggcttcgccgcgacccaggacaacctctgcctcgaacgcctgcgg
ctggcccgcatcggcggcaacgagcacgtggtggagcgcgaccgctcgatgatccgcgca
gtgcccaaggagtcgatcttcgtctccctggtgcagggcagccagtcgttcttctaccag
gacaacggctgcaacctcctgcaaccgggcgagctggttatctaccggaccgacaagccc
tacctgttcggtttttccggaccgatgcggcagttcatcttcgacattccccaggacgat
ttcgccgagcgctgcctgcgcgacttcaagggaccgctgaagatcggcgcggaaagcccg
gtgcagcgcctgctggtgcggaccctcggcgagcgtacccgggatttcctcgacagcccc
catggcgaggatgccgagcgctaccaggaggaagcctacgacctgctggcgagcatcatc
agcgaccatgccggcgagcaccgtgccagcgccctgggcgcgtcctacctgctggcggcc
aagcagtacatccagcagcacctcgacgaacccgccctgagctgcgagcgggtggccgcc
gccactggcgtctccagccggcacctggcgcggctgttcgcccaggaaggcagctcgccc
gggcgctacctgcaggagcggcgcctggagcgggcccgccagttgctcgcttcgccccag
ggccggcgcctggatgtcgccgaggtcgcctatcgccacggcttctccagccaggcgcat
ttcgcccgggccttcaaggcgcgctacgggatgacgccgagcgaggcgcgtggccgttag

DBGET integrated database retrieval system