KEGG   Pseudomonas aeruginosa PA1: PA1S_04835Help
Entry
PA1S_04835        CDS       T02928                                 

Definition
(GenBank) D-alanyl-D-alanine carboxypeptidase
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
paep  Pseudomonas aeruginosa PA1
Pathway
paep00550  Peptidoglycan biosynthesis
paep01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:paep00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    PA1S_04835
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:paep01002]
    PA1S_04835
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:paep01011]
    PA1S_04835
Enzymes [BR:paep01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     PA1S_04835
Peptidases [BR:paep01002]
 Serine Peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   PA1S_04835
Peptidoglycan biosynthesis and degradation proteins [BR:paep01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   PA1S_04835
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 PBP5_C Beta-lactamase2 Peptidase_S13 Beta-lactamase
Motif
Other DBs
NCBI-ProteinID: AHA17841
LinkDB All DBs
Structure
PDB: 

Position
1031992..1033152
Genome map
AA seq 386 aa AA seqDB search
MNITTIAKRLSLLVLFIAPTAGWAAESMVPAPPQLAAKSYVLMDGESGQVLVENNGDQRL
PPASLTKLMTAYIATKEIEAGRIGENDLVTVSEHAWRTGGSRMFIKVGSQVSVSDLLHGI
IIQSGNDASVALAEHIAGSEDAFADMMNTTAQKLGLTNSHFMDATGLPNPDHYSSARDMA
VLARAIIYGEPSHYAIYAQKEFLWNNIKQPNRNLLLWRDKTVDGLKTGHTDEAGYCLVAS
AVRDGQRMIAVVFGTNSEQARAAETQKLLTYGFRFFESRNFYKKGTELTKGLVWKGSEHE
VKAGLAEDLTMTLPRGQMQKLQASMVLEPQLMAPIQQGQVIGKVEVKLDDKVIRSADLVA
LNAVEEGGFFRRLWDSIRLFFYGLFN
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgaacatcaccactatcgcgaaacgcttgtcactgcttgtcctgttcatcgcccctacg
gctggctgggctgctgaatccatggttccggcgccgccgcaactggccgccaagtcgtac
gtcctgatggacggcgagagcggccaggttctggtcgagaacaacggcgaccagcgcctg
ccgccggccagcctgaccaaactgatgaccgcctacatcgccaccaaggagatcgaggcc
ggccgcatcggcgagaacgacctggtcaccgtcagcgaacatgcctggcgcaccggcggt
tcgcggatgttcatcaaggtcggcagccaggtctcggtgagcgacctgctgcatggcatc
atcatccagtccggcaacgacgccagcgtcgccctggccgagcatatcgccggcagcgaa
gacgccttcgccgacatgatgaacaccaccgcgcagaagctgggcctgaccaactcccac
ttcatggacgccaccggcctgcccaacccggaccactattcctccgcccgcgacatggcg
gtgctggcccgcgcgatcatctacggcgagccgagccactacgcgatctacgcgcagaag
gaattcctctggaacaacatcaagcagccgaaccgcaacctgctgctgtggcgcgacaag
accgtcgacggcctgaagaccggccacaccgacgaagccggctactgcctggtggcttcc
gcggtacgcgacggccagcgcatgatcgcggtggtgttcggcaccaacagcgagcaggcc
cgcgccgccgagacccagaagctgctgacctatggcttccgcttcttcgaaagccgcaac
ttctacaagaagggcaccgagctgaccaagggcctggtctggaagggttccgagcatgaa
gtgaaagccggcctcgccgaagacctgaccatgaccctgccgcgcggccagatgcagaag
ctgcaggccagtatggtcctggagccgcagctgatggcgccgatccagcagggccaggtg
atcggcaaggtggaagtgaagctggacgacaaggtcatccgcagcgccgacctggtcgcc
ctcaacgccgtcgaggagggtggtttcttccgccgcctgtgggatagcatccgcctgttc
ttctacggtttgttcaactga

DBGET integrated database retrieval system