KEGG   Pseudomonas aeruginosa PA1: PA1S_07185Help
Entry
PA1S_07185        CDS       T02928                                 

Definition
(GenBank) 3-hydroxyacyl-ACP dehydratase
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
paep  Pseudomonas aeruginosa PA1
Pathway
paep00061  Fatty acid biosynthesis
paep00780  Biotin metabolism
paep01100  Metabolic pathways
paep01212  Fatty acid metabolism
Module
paep_M00083  Fatty acid biosynthesis, elongation
paep_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:paep00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    PA1S_07185
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    PA1S_07185
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:paep01004]
    PA1S_07185
Enzymes [BR:paep01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     PA1S_07185
Lipid biosynthesis proteins [BR:paep01004]
 Fatty acid synthase
  Component type
   PA1S_07185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA 4HBT MaoC_dehydratas 4HBT_2
Motif
Other DBs
NCBI-ProteinID: AHA17416
LinkDB All DBs
Structure
PDB: 

Position
1507923..1508363
Genome map
AA seq 146 aa AA seqDB search
MMDINEIREYLPHRYPFLLVDRVVELDIEGKRIRAYKNVSINEPFFNGHFPEHPIMPGVL
IIEAMAQAAGILGFKMLDVKPADGTLYYFVGSDKLRFRQPVLPGDQLQLHAKFISVKRSI
WKFDCHATVDDKPVCSAEIICAERKL
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
atgatggacatcaacgagattcgcgaatacctgcctcatcgctatcctttcctgctggtg
gatcgggtggtagagctggacatcgagggcaagcgcattcgcgcctacaagaatgtcagt
atcaatgagccgttcttcaacggacatttccccgagcacccgatcatgccgggcgtgctg
atcatcgaggcgatggcccaggcggccggtatcctcggtttcaagatgctcgacgtgaag
cccgccgacggcaccctttactacttcgtcggttcggacaagctgcgcttccgccagccg
gtcctgccgggcgaccaactgcaactgcacgccaagttcatcagcgtgaagcgcagcatc
tggaaattcgactgccacgctaccgtcgacgacaagccggtatgctcggctgaaatcatc
tgtgcggaacgcaaactatga

DBGET integrated database retrieval system