KEGG   Pseudomonas aeruginosa PA1: PA1S_10525Help
Entry
PA1S_10525        CDS       T02928                                 

Definition
(GenBank) HAD family hydrolase
  KO
K01091  phosphoglycolate phosphatase [EC:3.1.3.18]
Organism
paep  Pseudomonas aeruginosa PA1
Pathway
paep00630  Glyoxylate and dicarboxylate metabolism
paep01100  Metabolic pathways
paep01110  Biosynthesis of secondary metabolites
paep01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:paep00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    PA1S_10525
Enzymes [BR:paep01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.18  phosphoglycolate phosphatase
     PA1S_10525
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like HAD Hydrolase_3 Hydrolase_6
Motif
Other DBs
NCBI-ProteinID: AHA16774
LinkDB All DBs
Position
2237952..2238644
Genome map
AA seq 230 aa AA seqDB search
MTDYALLVFDWDGTLVDSIARIVDSMKAAARETALPERDDTRIKGIIGLGLPEAIASLYP
EVGDPALVERFRCAYSEHYLAQEAQPSRLFPGVAEAMVHFREAGFRLAVATGKSRRGLDR
VLAGHGWSDFFDITRCADETASKPDPLMLHEILAHCRVEPGRALMIGDSPFDLEMARRAG
MDSVAVAYGAQSLEQLRPYAPRLEVEHFTELRAWLGGARREAVSGVVEHV
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atgactgactacgcgttgctggtattcgattgggacggcaccctggtcgactcgatcgcg
cgcatcgtcgattcgatgaaggcggcggcgcgggaaaccgctctgccggagcgggacgat
acccggatcaagggcatcatcggcctcggcttgcccgaggcgatcgcttcgctctatccg
gaggttggcgatcctgctctggtcgagcgtttccggtgtgcctacagcgagcattacctg
gcgcaggaagcgcagccgtcgcggttgttccccggcgtggccgaagccatggtgcatttt
cgcgaggccgggttccgcctggcggtcgccaccggcaagagtcggcgcggcctggaccgg
gtgctggcggggcatggctggagcgatttcttcgatatcacccgctgcgccgacgaaacg
gccagcaagccggacccgttgatgctccacgagatcctggcgcactgccgggtcgagccg
gggcgggcgctgatgatcggtgattcgccgttcgacctggaaatggcgcgacgggcgggg
atggattcggttgcggtggcctatggcgcccaatcgctggagcagttgcggccttatgcg
ccgcggctggaagttgagcatttcaccgagttgcgcgcctggttgggcggtgctcgacgt
gaggcggtttcaggagtggttgagcatgtctga

DBGET integrated database retrieval system