KEGG   Pseudomonas aeruginosa PA1: PA1S_11275Help
Entry
PA1S_11275        CDS       T02928                                 

Definition
(GenBank) aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
paep  Pseudomonas aeruginosa PA1
Pathway
paep00220  Arginine biosynthesis
paep00250  Alanine, aspartate and glutamate metabolism
paep00290  Valine, leucine and isoleucine biosynthesis
paep01100  Metabolic pathways
paep01110  Biosynthesis of secondary metabolites
paep01130  Biosynthesis of antibiotics
paep01210  2-Oxocarboxylic acid metabolism
paep01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:paep00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PA1S_11275
   00290 Valine, leucine and isoleucine biosynthesis
    PA1S_11275
   00220 Arginine biosynthesis
    PA1S_11275
Enzymes [BR:paep01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     PA1S_11275
    2.6.1.66  valine---pyruvate transaminase
     PA1S_11275
Amino acid related enzymes [BR:paep01007]
 Aminotransferase (transaminase)
  Class I
   PA1S_11275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: AHA16628
LinkDB All DBs
Position
complement(2386972..2388183)
Genome map
AA seq 403 aa AA seqDB search
MQVSKSNKLANVCYDIRGPVLKHAKRLEEEGHRILKLNIGNPAPFGFEAPEEILQDVIRN
LPTAQGYSDSKGLFSARKAVMQYYQQKQVEGVGIEDIYLGNGVSELIVMSMQALLNNGDE
VLIPAPDYPLWTAAVSLAGGKPVHYLCDEQANWWPDLEDIKAKITPNTRAMVIINPNNPT
GAVYSREVLEGMVELARQHNLVLFSDEIYDKILYDGAVHVSTASLAPDVLCLTFNGLSKS
YRVAGFRSGWVAISGPKQRAQSYIEGLDILANMRLCANVPAQHAIQTALGGYQSINDLVL
PPGRLLEQRNRAWELLNDIPGVSCVKPMGALYAFPRIDPKVCPIHNDEKFVLDLLLSEKL
LIVQGTAFNWPWPDHFRVVTLPRVDDLEQAILRIGSFLKGYQQ
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgcaggtcagcaaatcgaacaagctcgccaacgtctgctatgacattcgcgggccggtg
ctcaagcacgccaaacgcctagaggaagagggtcaccgcatcctcaagctgaatatcggc
aacccggcgccgttcggtttcgaagctcccgaggaaattctccaggacgtcatccgcaac
ctgccgaccgcccagggctacagcgactccaagggcctgttcagcgcgcgcaaggcagtg
atgcagtattaccagcagaagcaggtggaaggcgtcggcatcgaggacatctacctcggc
aacggcgtgtcggaactgatcgtgatgtccatgcaggcgctgctgaacaacggcgacgag
gtgctgatccccgctcccgactacccgctgtggaccgccgccgtcagcctcgccggcggc
aagccggtgcactacctgtgcgacgagcaggccaactggtggccggacctggaagacatc
aaggcgaagatcacgccgaataccagggcgatggtgatcatcaacccgaacaaccccacc
ggcgcggtgtattccagggaagtgctggaaggcatggtcgaactggcccgccagcacaac
ctggtgctgttctccgacgagatctacgacaagatcctctacgacggcgccgtccacgtc
tccaccgcctcgctggcgccggacgtgctctgcctgaccttcaacggcctgtccaaatcc
taccgggtggccggcttccgctccggctgggtggcgatctccgggcccaagcagcgggca
cagagctatatcgaaggtctcgacatcctcgccaacatgcgcctgtgcgccaacgtcccg
gcgcagcacgcgatccagaccgccctgggcggctaccagagcatcaacgatctggtcctg
ccgccggggcgcctgctggagcagcgcaaccgcgcctgggaactgctcaacgacatcccc
ggcgtcagctgcgtgaagccgatgggcgcgctgtacgccttcccgcggatcgatccgaag
gtctgcccgatccacaacgacgaaaagttcgtcctcgacctgctgctctcggaaaaactg
ctgatcgtccagggcaccgccttcaactggccgtggcccgaccacttccgggtggtcacc
ctgccccgcgtcgacgacctggagcaggcgatcctgcgcatcggcagcttcctcaagggc
taccagcagtaa

DBGET integrated database retrieval system