KEGG   Pseudomonas aeruginosa PA1: PA1S_11275Help
Entry
PA1S_11275        CDS       T02928                                 

Definition
(GenBank) aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
paep  Pseudomonas aeruginosa PA1
Pathway
paep00250  Alanine, aspartate and glutamate metabolism
paep01100  Metabolic pathways
paep01110  Biosynthesis of secondary metabolites
paep01130  Biosynthesis of antibiotics
paep01210  2-Oxocarboxylic acid metabolism
paep01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:paep00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PA1S_11275
   00290 Valine, leucine and isoleucine biosynthesis
    PA1S_11275
   00220 Arginine biosynthesis
    PA1S_11275
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:paep01007]
    PA1S_11275
Enzymes [BR:paep01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     PA1S_11275
    2.6.1.66  valine---pyruvate transaminase
     PA1S_11275
Amino acid related enzymes [BR:paep01007]
 Aminotransferase (transaminase)
  Class I
   PA1S_11275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: AHA16628
LinkDB All DBs
Position
complement(2386972..2388183)
Genome map
AA seq 403 aa AA seqDB search
MQVSKSNKLANVCYDIRGPVLKHAKRLEEEGHRILKLNIGNPAPFGFEAPEEILQDVIRN
LPTAQGYSDSKGLFSARKAVMQYYQQKQVEGVGIEDIYLGNGVSELIVMSMQALLNNGDE
VLIPAPDYPLWTAAVSLAGGKPVHYLCDEQANWWPDLEDIKAKITPNTRAMVIINPNNPT
GAVYSREVLEGMVELARQHNLVLFSDEIYDKILYDGAVHVSTASLAPDVLCLTFNGLSKS
YRVAGFRSGWVAISGPKQRAQSYIEGLDILANMRLCANVPAQHAIQTALGGYQSINDLVL
PPGRLLEQRNRAWELLNDIPGVSCVKPMGALYAFPRIDPKVCPIHNDEKFVLDLLLSEKL
LIVQGTAFNWPWPDHFRVVTLPRVDDLEQAILRIGSFLKGYQQ
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgcaggtcagcaaatcgaacaagctcgccaacgtctgctatgacattcgcgggccggtg
ctcaagcacgccaaacgcctagaggaagagggtcaccgcatcctcaagctgaatatcggc
aacccggcgccgttcggtttcgaagctcccgaggaaattctccaggacgtcatccgcaac
ctgccgaccgcccagggctacagcgactccaagggcctgttcagcgcgcgcaaggcagtg
atgcagtattaccagcagaagcaggtggaaggcgtcggcatcgaggacatctacctcggc
aacggcgtgtcggaactgatcgtgatgtccatgcaggcgctgctgaacaacggcgacgag
gtgctgatccccgctcccgactacccgctgtggaccgccgccgtcagcctcgccggcggc
aagccggtgcactacctgtgcgacgagcaggccaactggtggccggacctggaagacatc
aaggcgaagatcacgccgaataccagggcgatggtgatcatcaacccgaacaaccccacc
ggcgcggtgtattccagggaagtgctggaaggcatggtcgaactggcccgccagcacaac
ctggtgctgttctccgacgagatctacgacaagatcctctacgacggcgccgtccacgtc
tccaccgcctcgctggcgccggacgtgctctgcctgaccttcaacggcctgtccaaatcc
taccgggtggccggcttccgctccggctgggtggcgatctccgggcccaagcagcgggca
cagagctatatcgaaggtctcgacatcctcgccaacatgcgcctgtgcgccaacgtcccg
gcgcagcacgcgatccagaccgccctgggcggctaccagagcatcaacgatctggtcctg
ccgccggggcgcctgctggagcagcgcaaccgcgcctgggaactgctcaacgacatcccc
ggcgtcagctgcgtgaagccgatgggcgcgctgtacgccttcccgcggatcgatccgaag
gtctgcccgatccacaacgacgaaaagttcgtcctcgacctgctgctctcggaaaaactg
ctgatcgtccagggcaccgccttcaactggccgtggcccgaccacttccgggtggtcacc
ctgccccgcgtcgacgacctggagcaggcgatcctgcgcatcggcagcttcctcaagggc
taccagcagtaa

DBGET integrated database retrieval system