KEGG   Pseudomonas aeruginosa PA1: PA1S_13080Help
Entry
PA1S_13080        CDS       T02928                                 

Definition
(GenBank) anthranilate 1,2-dioxygenase small subunit
  KO
K05600  anthranilate 1,2-dioxygenase (deaminating, decarboxylating) small subunit [EC:1.14.12.1]
Organism
paep  Pseudomonas aeruginosa PA1
Pathway
paep00627  Aminobenzoate degradation
paep01100  Metabolic pathways
paep01120  Microbial metabolism in diverse environments
Module
paep_M00637  Anthranilate degradation, anthranilate => catechol
Brite
KEGG Orthology (KO) [BR:paep00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    PA1S_13080
Enzymes [BR:paep01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.12  With NADH or NADPH as one donor, and incorporation of two atoms of oxygen into the other donor
    1.14.12.1  anthranilate 1,2-dioxygenase (deaminating, decarboxylating)
     PA1S_13080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ring_hydroxyl_B SnoaL_4 SnoaL_2 CaM-KIIN
Motif
Other DBs
NCBI-ProteinID: AHA16285
LinkDB All DBs
Position
complement(2753910..2754401)
Genome map
AA seq 163 aa AA seqDB search
MNAGLQYRVEQFLYRHAELCDAQDWDGYLAQFDEQCEFHLPQWESEQRYTRDPKREMSLI
YYPSRAGLEDRVFRIRTGKAASTVPMPRTLHQIGNVRIAEEGDGLLRVRVNWQTLFQRLD
QTGSFFGHATYRLKPHGEAWLIARKHIVLLNDRIDSVLDFYHL
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgaacgccggactgcagtaccgcgtcgaacagttcctctaccgccacgccgaactctgc
gatgcccaggactgggacggctacctcgcgcagttcgacgaacagtgcgagttccacctg
ccgcagtgggagtccgagcagcgctacacccgcgatccgaagcgcgagatgtcgctgatc
tactaccccagccgtgccggcctggaagaccgggtgttccgtatccgcaccggcaaggcc
gcgtccaccgtgccgatgccgcgcaccctgcaccagatcggcaacgtgcgcatcgccgag
gaaggcgacggcctgctgcgagtgcgggtcaactggcagaccctgttccagcgcctggac
cagaccggcagcttcttcggccatgccacctaccgcctgaaaccccatggcgaggcctgg
ctgatcgcgcgcaagcacatcgtcctgctcaacgaccggatcgactcggtcctcgacttc
taccacctctga

DBGET integrated database retrieval system