KEGG   Pseudomonas aeruginosa PA1: PA1S_14260Help
Entry
PA1S_14260        CDS       T02928                                 

Definition
(GenBank) cell division protein
  KO
K03587  cell division protein FtsI (penicillin-binding protein 3) [EC:3.4.16.4]
Organism
paep  Pseudomonas aeruginosa PA1
Pathway
paep00550  Peptidoglycan biosynthesis
paep01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:paep00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    PA1S_14260
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    PA1S_14260
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:paep01011]
    PA1S_14260
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:paep03036]
    PA1S_14260
Enzymes [BR:paep01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     PA1S_14260
Peptidoglycan biosynthesis and degradation proteins [BR:paep01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   PA1S_14260
Chromosome and associated proteins [BR:paep03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Divisome proteins
    PA1S_14260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer
Motif
Other DBs
NCBI-ProteinID: AHA16051
LinkDB All DBs
Position
complement(3066665..3068362)
Genome map
AA seq 565 aa AA seqDB search
MSSQRRNYRFILVVTLFVLASLAVSGRLVYLQVHDHEFLADQGDLRSIRDLPIPVTRGMI
TDRNGEPLAVSTEVASIWCNPREMAAHLDEVPRLAGALHRPAAPLLAQLQANPNKRFLYL
ERGLSPIEASEVMALGITGVHQIKEYKRFYPSSELTAQLIGLVNIDGRGQEGTELGFNDW
LSGKDGVREVAINPRGSLVNSIKVLKTPKASQDVALSIDLRLQFIAYKALEKAVLKFGAH
SGSAVLVNPKSGQILAMANFPSYNPNNRASFAPAFMRNRTLTDTFEPGSVIKPFSMSAAL
ASGKFDENSQVSVAPGWMTIDGHTIHDVARRDVLTMTGVLINSSNIGMSKVALQIGPKPI
LEQLGRVGFGAPLSLGFPGENPGYLPFHEKWSNIATASMSFGYSLAVNTAELAQAYSVFA
NDGKLVPLSLLRDNPQNQVRQAMDPQIARRIRAMLQTVVEDPKGVVRARVPGYHVAGKSG
TARKASGRGYADKSYRSLFVGMAPASDPQLVLAVMIDSPTRIGYFGGLVSAPTFSDIMAG
SLRALAIPPDNLQDSPAVADRQHHG
NT seq 1698 nt NT seq  +upstreamnt  +downstreamnt
atgagcagtcaacgccgaaactaccgcttcatccttgtcgtcaccctgttcgtcctcgcc
tccctggccgtctccggacggttggtctatctccaggtccacgaccacgaattcctcgcc
gaccagggcgaccttcgctcgatccgcgacctgccgatcccggtcacccgcggcatgatc
accgaccgcaacggcgagccgctggcggtatccaccgaagtcgcgtcgatctggtgcaac
cccagggaaatggccgcccacctcgacgaggtgccgcgcctggccggcgccctgcaccgc
cctgcggcgccgctgctggcccagctccaggccaacccgaacaagcgcttcctctacctc
gagcgcggcctgtcgccgatcgaggccagcgaggtgatggccctgggcataacgggggta
caccagatcaaggaatacaagcgtttctaccccagttccgagctgaccgcgcagttgatc
ggcctggtcaacatcgacggccgcggccaggaaggcaccgaactgggcttcaacgactgg
ctgagcggcaaggacggggtacgcgaggtggcgatcaacccgcgcggctcgctggtcaac
agcatcaaggtgctgaagacgcccaaggccagccaggacgtggccctgagcatcgacctg
cgactacagttcatcgcctacaaggcgctggaaaaggccgtgctcaagttcggcgcgcac
tccggctcggcggtcctggtgaacccgaagagcgggcagatcctggcgatggccaacttc
ccctcctacaacccgaacaaccgcgccagcttcgccccggccttcatgcgcaaccgcacc
ctcaccgataccttcgagccgggctcggtgatcaagccgttcagcatgtcggcggcgctg
gcctccggcaagttcgacgagaacagtcaagtcagcgtggcaccgggctggatgaccatc
gacgggcacaccatccacgacgtcgcccggcgcgacgtactgaccatgaccggggtactg
atcaactcctcgaacatcggcatgagcaaggtcgccctgcagatcgggcccaagccgatc
ctcgaacagctcggccgggtcggtttcggcgcgccgctgtcgctgggcttccccggcgag
aacccgggctacctgccgttccacgagaaatggtcgaacatcgccaccgccagcatgtcg
ttcggctacagcctggcggtgaacaccgccgagctggcccaggcctactcggtgttcgcc
aacgacggcaagctggtgccgctcagcctgctccgcgacaacccgcagaaccaggtgcga
caggcgatggacccgcagatcgcacggcgcatccgggcgatgctgcaaaccgtggtggaa
gacccgaagggcgtggtccgcgcccgcgtgccgggctaccacgtggcgggcaagagcggc
accgcgcgcaaggcctcgggccggggctacgcggacaagtcctaccgttcgctgttcgtc
ggcatggcgccggcgtccgacccgcaactggtgctggcggtgatgatcgattcgccgacc
aggatcggctacttcggcggcctggtctcggcgcccaccttcagcgacatcatggccgga
tcgctacgcgccctggcgatcccgccggacaacctgcaggacagcccggccgtcgccgac
cgccagcaccacggctga

DBGET integrated database retrieval system