KEGG   Pseudomonas aeruginosa PA1: PA1S_23950Help
Entry
PA1S_23950        CDS       T02928                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
paep  Pseudomonas aeruginosa PA1
Pathway
paep00473  D-Alanine metabolism
paep00550  Peptidoglycan biosynthesis
paep01100  Metabolic pathways
paep01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:paep00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    PA1S_23950
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    PA1S_23950
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    PA1S_23950
Enzymes [BR:paep01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     PA1S_23950
Peptidoglycan biosynthesis and degradation proteins [BR:paep01011]
 Precursor biosynthesis
  Amino acid ligase
   PA1S_23950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp ATP-grasp_4 ATPgrasp_Ter ATP-grasp_3 ATPgrasp_YheCD RimK ATP-grasp_5 GARS_A TTL
Motif
Other DBs
NCBI-ProteinID: AHA18254
LinkDB All DBs
Position
complement(5154542..5155501)
Genome map
AA seq 319 aa AA seqDB search
MNLCLDSLLNGTQDPKAFGRVAVLFGGKSAEREVSLKSGAMVLQSLLAAGVDAFGIDVGE
DLLQRLVEEKIDRVFIILHGRGGEDGSMQGLLECAGIPYTGSGVLASALAMDKLRTKRVW
LSLGLPTPDYAVLASEDDCREAAQRLGFPLIVKPAHEGSSIGMAKVGGLDELIAAWREAA
RYDSQVLVEQWISGPEFTVATLRGQVLPAIRLGTPHTFYDYDAKYLASDTRYQVPCGLDE
AKERELKELTARACDALGIQGWGRADVMQDAEGRFWLLEVNTAPGMTDHSLVPMAARAAG
LDFQQLVLAILADSREARG
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaacctttgcctcgatagcctgctgaacggcacccaggatcccaaggcgttcggccgt
gtcgccgtgctgttcggcggcaagagcgccgagcgcgaggtgtcgctgaagtccggcgcg
atggtcctgcaatccctgctggccgccggggtcgatgccttcggcatcgatgtcggcgaa
gacctgctgcaacgcctggtcgaggagaagatcgaccgtgtcttcatcattctccacggt
cgtggcggcgaggatggcagcatgcagggcctgctcgagtgcgcgggcattccctacacc
ggcagcggcgtgctggcctcggcgctggcgatggacaagctgcggaccaagcgggtctgg
ctcagcctcggcctgccgaccccggactacgcggtgttggccagcgaggatgactgccgc
gaagcggcgcagcgactgggtttcccgctgatcgtcaagccggctcacgaaggctcgagc
atcggcatggccaaggtcggcgggctagacgaattgatcgcggcgtggcgcgaagcggcc
cgctacgactcgcaggtgctggtcgagcagtggatcagcggcccggaattcaccgtggcg
accttgcgcgggcaggtgctgccggcgatccgcctgggcacgccgcacaccttctacgac
tacgacgccaagtacctggccagcgatacccgctaccaggtgccctgcggtctcgacgag
gccaaggaacgcgagctgaaggaactcaccgcgcgcgcctgcgacgccctgggcatccag
ggctgggggcgggcggacgtgatgcaggacgccgaagggcgtttctggctgcttgaagtc
aacaccgcaccaggcatgaccgaccacagcctggtgcctatggccgcgcgggccgccggc
ctggatttccagcaactggtgctggcgatcctggccgatagccgcgaggcgaggggataa

DBGET integrated database retrieval system