KEGG   Pseudomonas aeruginosa PA1: PA1S_27345Help
Entry
PA1S_27345        CDS       T02928                                 

Definition
(GenBank) peptidase
  KO
K05366  penicillin-binding protein 1A [EC:2.4.1.129 3.4.16.4]
Organism
paep  Pseudomonas aeruginosa PA1
Pathway
paep00550  Peptidoglycan biosynthesis
paep01100  Metabolic pathways
paep01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:paep00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    PA1S_27345
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    PA1S_27345
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:paep01003]
    PA1S_27345
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:paep01011]
    PA1S_27345
Enzymes [BR:paep01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     PA1S_27345
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     PA1S_27345
Glycosyltransferases [BR:paep01003]
 Polysaccharide
  Bacterial polysaccharide
   PA1S_27345
Peptidoglycan biosynthesis and degradation proteins [BR:paep01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   PA1S_27345
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly Transpeptidase PCB_OB
Motif
Other DBs
NCBI-ProteinID: AHA18898
LinkDB All DBs
Structure
PDB: 

Position
5905397..5907868
Genome map
AA seq 823 aa AA seqDB search
MRLLKFLWWTCVTLICGVLLSFSGAYLYLSPSLPSVEALRNVQLQIPLKVYSEDGKLISE
FGEMRRTPIRFSDIPQDFIHALLSAEDDNFANHYGVDVKSLMRAAAQLLKSGHIQTGGST
ITMQVAKNYFLTNERSFSRKINEILLALQIERQLTKDEILELYVNKIYLGNRAYGIEAAA
QVYYGKPIKDLSLAEMAMIAGLPKAPSRYNPLVNPTRSTERRNWILERMLKLGFIDQQRY
QAAVEEPINASYHVQTPELNAPYIAEMARAEMVGRYGSEAYTEGYKVITTVRSDLQNAAS
QSVRDGLIDYDQRHGYRGPETRLPGQTRDAWLKHLGQQRSIGGLEPAIVTQVEKSGIMVM
TRDGKEEAVTWDSMKWARPFLSNNSMGPMPRQPADVAQAGDQIRVQRQEDGTLRFVQIPA
AQSALISLDPKDGAIRSLVGGFSFEQSNYNRAIQAKRQPGSSFKPFIYSAALDNGFTAAS
LVNDAPIVFVDEYLDKVWRPKNDTNTFLGPIPLREALYKSRNMVSIRVLQGLGIERAISY
ITKFGFQRDELPRNFSLALGTATVTPMEIAGAWSVFANGGYKVNPYVIERIESRDGQVLY
QANPPRVPVEEQVAAPDAEDAGNPGDPEHPESAEGEGSIEAQQVAAKAQTTFEPTPAERI
IDARTAYIMTSMLQDVIKRGTGRRALALKRTDLAGKTGTTNDSKDGWFSGYNSDYVTSVW
VGFDQPETLGRREYGGTVALPIWIRYMGFALKDKPMHTMAEPPGIVSLRIDPVTGRSAAP
GTPGAYFEMFKNEDTPPSVNELPPGSFPGSPLPDDEGAPIDLF
NT seq 2472 nt NT seq  +upstreamnt  +downstreamnt
atgcgcctgctgaagttcctgtggtggacttgcgtcaccctgatttgtggagtgctgctc
agtttcagcggcgcctatctctatctgagtcccagcctgccctcggtggaagctctgcgt
aacgtccagctgcagatccccctcaaggtctacagcgaggacggcaagctgatctccgag
ttcggcgagatgcgtcggacgccgatccgcttctccgacatcccgcaggacttcatccat
gccctgctgtccgccgaggacgacaatttcgccaaccattatggcgtcgatgtgaaaagc
ctaatgcgcgccgccgcgcaattattgaaaagcggtcacatccagactggcggcagcacc
atcaccatgcaggtagcgaagaactacttccttaccaatgaaagaagcttctcgcgaaag
atcaatgaaatcctcctggccctgcagatcgagcgacagctgaccaaggacgagatcctc
gagctctacgtcaacaagatctacctgggcaaccgtgcctatggcatcgaggctgccgca
caggtctattacggcaagccgatcaaagacttgagcctggccgagatggcgatgatcgcc
ggcctgccgaaagcgccctcgcgctacaacccgctggtcaacccgacccgcagtacggag
cggcgcaactggatcctcgagcgcatgctcaagctcggcttcatcgaccagcaacgctac
caggccgccgtcgaggagccgatcaacgcctcctaccacgtgcagacccccgaactgaat
gcgccctacatcgccgagatggcccgtgccgagatggtcggccgctacggcagcgaggcc
tataccgagggctacaaggtcatcaccacggtccgcagcgacctgcagaacgccgccagc
caatcggtccgcgacggcctcatcgactatgaccagcgccacggctaccgcggcccggag
acccgcctgccgggccagacccgcgacgcctggctcaagcacctgggccagcagcgcagc
atcggcggcctggagccggcgatcgtcacccaggtggaaaagagcgggatcatggtgatg
acccgcgacggcaaggaagaagccgtgacctgggacagcatgaaatgggcacgccccttc
ctcagcaacaacagcatgggcccgatgccgcgccagcccgccgacgtggcccaggccggc
gaccagatccgcgtgcagcgccaggaagacggcaccctgcgcttcgtacagattcccgcc
gcacagagcgcgctgatctccctcgacccgaaggacggggcgatccgctcgctggtcggc
ggcttctccttcgagcagagcaactacaaccgcgcgatccaggccaagcgccagccgggc
tccagtttcaagccgttcatctacagcgcggccctggacaacggcttcaccgccgccagc
ctggtcaacgatgcgccgatcgtgttcgtcgacgagtacctggacaaggtctggcgaccg
aagaacgacaccaataccttcctcggcccgatcccgctgcgcgaagccctgtacaagtcc
cgcaacatggtctcgatccgcgtcctgcagggcctgggcatcgagcgggcgatcagctac
atcaccaagttcggcttccagcgcgacgaactgccgcgcaacttctccctggccctgggt
accgcgacagtcacaccgatggaaatcgccggcgcctggagcgtattcgccaacggcggc
tacaaggtcaatccgtacgtcatcgaacgcatcgagagccgcgacggacaggtgctgtac
caggccaatccgccccgcgtgccggtggaagaacaggtcgctgcgccggatgcggaagac
gccgggaatcctggtgaccccgagcatccggagagcgccgaaggcgaaggttcgatcgaa
gcccagcaagtcgccgccaaggcccagaccaccttcgagccgaccccggccgagcggatc
atcgatgcccgtaccgcctatatcatgaccagcatgctgcaggacgtgatcaagcgcggt
accgggcgtcgcgccctggcgctgaagcgcaccgacctagccggcaagaccggcaccacc
aacgattccaaggatggctggttctccggctacaactccgactacgtgaccagcgtctgg
gtcggcttcgaccagccggagaccctgggtcgccgcgagtacggcggtaccgtcgcgctg
ccgatctggatcaggtacatgggcttcgccctcaaggacaagccgatgcacaccatggcc
gagccgccaggcatcgtcagcctgcgcatcgacccggtgaccggccgttcggccgcgccg
ggcactcccggcgcctatttcgagatgttcaagaacgaggataccccgccctcggtcaat
gaactgccgccaggcagcttccctggcagcccgctgccggatgacgaaggcgcgccgatc
gacctgttctga

DBGET integrated database retrieval system