KEGG   Paenibacillus sp. FSL R5-0912: R50912_04620Help
Entry
R50912_04620      CDS       T03334                                 

Definition
(GenBank) beta-galactosidase
  KO
K12308  beta-galactosidase [EC:3.2.1.23]
Organism
paeq  Paenibacillus sp. FSL R5-0912
Pathway
paeq00052  Galactose metabolism
Brite
KEGG Orthology (KO) [BR:paeq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    R50912_04620
Enzymes [BR:paeq01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     R50912_04620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_42 Glyco_hydro_42M Glyco_hydro_42C Cellulase Glyco_hydro_14 Glyco_hydro_35 RHS Glyco_hydro_1
Motif
Other DBs
NCBI-ProteinID: AIQ39394
UniProt: A0A089L3I8
LinkDB All DBs
Position
1031495..1033474
Genome map
AA seq 659 aa AA seqDB search
MQIGVDYYPEHWDESMWETDIKLMKETGVKVVRVAEFAWSRLEPVEGTFDFAWLDRALDL
FHAYGIQIVIGTPTATPPRWLTSAYPDVLPVFADGGVFHPGVRGHRCYNSASLRKYGRRI
IEALARHYSGHPAVIGWQTDNEFSMLDCHCDSCNLAFRKWVQEKYSTLAQVNAEWGTVVW
SGEYSSWDELTVPYGGSPFQNPSLLLDFQRFQWDAVIAFQKMQTEVLREICPKHFITHNF
HSYPQRLDMHGLAEDLDVAAFDYYPNPSPKKQTTAPYSGALSLDLTRGIKRRNFWIMEQL
SGPPGCWFPMWRTPNPGFIRAYAWQAIARGADTVVHFRWRSSVAGAEQFWHGLIDHSNVP
GRRFAEFAQLCSEVNGLAPLLTGTKVISQAAILYSHEQLAALRIQPQAEGLDYYDNIKQY
HRALTKLGIGCDVIDWRQPLEGYKLVIVPSLYLHDEEAAQLLETFAGGGGIVILTHRSGV
KNMNNICVMQPLPGLFSRAAGVTVEEYDPIGGEVHSLRSAEGLLYECSQWCDILRPAGAE
PVAWYEDDFFAGAPAVTVNRFGAGQVYYIGTHAGENYWLKLLSDIALDVGLELFPELPEG
VQAFKRTGERGGLLFLLNLSRTPQTVGLNKLYRSAFTGTLMTGPVELAAYGVEILETEG
NT seq 1980 nt NT seq  +upstreamnt  +downstreamnt
gtgcagatcggtgtggattattaccccgaacattgggatgagtctatgtgggagacggat
attaaattaatgaaggaaaccggagtcaaggtggtccgggtggcggaatttgcctggagc
cggcttgagccggtagaggggacctttgatttcgcctggctggaccgggcgctggatctg
ttccacgcctacggaattcagattgtgatcgggacgccgacagcgacaccgccgcgctgg
ctgacttctgcctacccggatgtgctgcctgtgttcgcagatggaggtgtattccatccg
ggagtacgcggccaccgctgttacaacagcgcatcgctgcggaagtatggccgccggatt
attgaggcgctggcccgtcattacagcggtcatcctgccgttatcggctggcagacggac
aatgaattcagtatgctggattgccattgtgacagctgcaacctggcgttccgcaagtgg
gttcaggagaagtacagcacactcgcgcaggttaacgcagagtggggaactgtggtctgg
agcggagagtacagcagctgggacgagctgacggtgccttacggcggctcaccattccag
aatccctcgctgctgctggatttccagcggttccaatgggatgcggtgatcgctttccag
aagatgcagacggaagtgctgcgcgagatctgcccgaagcactttatcacccacaacttc
catagttatcctcagcggctggacatgcacgggctggctgaggatcttgatgtggctgcc
ttcgattattatccgaacccttcgccgaagaagcagacgacggctccctacagcggcgcg
ctatccctggatctgacccgcggcatcaaacgccgcaatttctggatcatggagcagctg
agcggcccgccgggctgctggttcccaatgtggcggactcctaacccggggtttatccgc
gcttatgcctggcaggcgattgccagaggcgcagataccgtggtgcatttccgctggaga
agctccgtagccggggcagaacagttctggcatgggctgatcgaccacagcaatgtgccc
gggcggagatttgccgagttcgcgcagctatgcagtgaggtgaacggtttggctccgctg
ctgacggggactaaggttatcagccaggcggctatcctgtattcgcatgagcagctggct
gcgctgcgcatccagcctcaggctgaaggattggactactacgataacattaagcagtac
caccgggcgctgacgaagcttggtatcgggtgcgatgtcatcgactggcggcagccgctt
gagggttacaagctggtgattgtcccgagcctgtacctgcatgatgaggaagctgcacaa
ctgctggagacttttgccggaggtggcggaatcgtgatccttacccatcgcagcggtgtg
aagaatatgaacaacatctgtgtaatgcagccactgccagggctcttctcccgtgcagcg
ggtgtaacggtggaggaatatgatccgatcggaggcgaagttcattcgcttcgcagcgct
gagggccttctgtatgaatgcagccagtggtgcgacattctgcggccggcgggagccgag
ccggtcgcctggtatgaagacgatttctttgccggagctcctgcggtcaccgtaaaccgc
ttcggagcgggccaggtttattatatcggaacacatgccggggagaactactggctgaag
cttttgagtgatatcgcgctagacgttgggcttgagctgttcccggaattaccggagggt
gtacaggcattcaagcgcacaggagagagagggggactgctgtttctgctgaatcttagc
cggacgcctcagactgtagggctaaacaagctttaccgcagcgcttttaccggtaccctg
atgactggcccggtagagcttgcggcgtatggtgtagagattctggagactgaaggctga

DBGET integrated database retrieval system