KEGG   Paenibacillus sp. FSL R5-0912: R50912_05380Help
Entry
R50912_05380      CDS       T03334                                 

Definition
(GenBank) DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
paeq  Paenibacillus sp. FSL R5-0912
Pathway
paeq03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:paeq00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    R50912_05380
Enzymes [BR:paeq01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     R50912_05380
DNA repair and recombination proteins [BR:paeq03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     R50912_05380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C mRNA_cap_enzyme RNA_ligase
Motif
Other DBs
NCBI-ProteinID: AIQ39531
UniProt: A0A089JS04
LinkDB All DBs
Position
complement(1215485..1216432)
Genome map
AA seq 315 aa AA seqDB search
MQPIIPFEPVLASRLPEGEEWIAQIKWDGVRMLSYSDGSHAELINRRGNRRTLQYPELAR
PEAYCRAGSVILDGEIIALSGGKPSFHEVMRRDSLKNEAAIRAVSPQVPVLYMVFDILYC
NGIWLLDQPLSRRQQMLSEMLLPHPHVQNVPSYHQPAQLYAAALKGGLEGIVCKELTSTY
APGGKDKRWQKCKIISDVTAVAGGVTFRDGLVNALLFGLYDDAGKLHYIGHAGAGKMTVQ
DWRNLTAQISGLITEQMPFAELPQRSKGSVWIKPELVFKLHYLEWNTSGTFRQPVIQSQV
ELPPLSCRMDQRTQT
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
ctgcagccgattattccattcgagcccgtgctggcctccaggctcccggagggcgaggag
tggatcgcccagatcaaatgggatggcgtgcggatgctctcctattccgatggaagccat
gccgagctgatcaaccggcggggcaaccggcgcacgctgcagtatcctgagcttgccaga
ccggaggcgtattgccgggccggttcggtcattctcgatggcgagattattgcactcagc
ggcggcaagccctccttccatgaggtgatgcggcgggacagcctgaagaatgaagcagcg
atccgggcggtaagtccgcaggtaccggtgctctatatggtcttcgatatcctgtactgc
aatggcatttggctgctggaccagccgttgtcccggcggcagcagatgttaagtgaaatg
ctgctgccgcatccccatgtgcagaatgtgccaagctaccatcagcccgcacagctgtac
gctgccgctctgaagggcgggctggaggggattgtatgcaaagagctcaccagtacctat
gccccgggaggcaaagacaagcgctggcagaaatgcaaaattatctccgatgtcactgct
gtagccggcggcgtcaccttccgtgacggtctggttaacgccctgctcttcggactatat
gatgatgcgggcaagctgcactatatcggccatgcaggagcaggcaaaatgaccgtacag
gactggcggaatttgaccgcacagatcagcggcctgatcacagagcagatgccttttgca
gagctgccccagcgcagtaaagggtcggtctggattaagcctgagctggtgttcaagctg
cactatctggaatggaatacttccggaaccttccgccagccggttatacagtcccaggta
gagctccctccgctatcctgccgcatggaccagagaacacagacgtag

DBGET integrated database retrieval system