KEGG   Paenibacillus sp. FSL R5-0912: R50912_18830Help
Entry
R50912_18830      CDS       T03334                                 

Definition
(GenBank) dienelactone hydrolase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
paeq  Paenibacillus sp. FSL R5-0912
Pathway
paeq00010  Glycolysis / Gluconeogenesis
paeq00020  Citrate cycle (TCA cycle)
paeq00620  Pyruvate metabolism
paeq01100  Metabolic pathways
paeq01110  Biosynthesis of secondary metabolites
paeq01120  Microbial metabolism in diverse environments
paeq01130  Biosynthesis of antibiotics
paeq01200  Carbon metabolism
Module
paeq_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:paeq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    R50912_18830
   00020 Citrate cycle (TCA cycle)
    R50912_18830
   00620 Pyruvate metabolism
    R50912_18830
Enzymes [BR:paeq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     R50912_18830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H Biotin_lipoyl_2 NQRA RnfC_N ATP-synt_ab_Xtn HlyD_3
Motif
Other DBs
NCBI-ProteinID: AIQ41859
UniProt: A0A089LAM8
LinkDB All DBs
Position
complement(4314306..4315958)
Genome map
AA seq 550 aa AA seqDB search
MAKFEYRFPELGEGLHEGEIIKMHIKAGDKVTDDDIVMEVQNDKAVVEVPCPVNGTVLEV
FTKDGQVCRVGEVVAIIDAEGEVPEQEGGHPAEQASQEADAAKGGADTTSSPAASSPATG
GTSNFEYKFPELGEGLHEGEIIKMHIKVGDKITDDDIIMEVQNDKAVVEVPSPVNGTVVE
VFTKDGQVCRVGEVVAIIAAEGDVPQQEGGHAEASGAQAAAPSQAPAAAAAAPAPNREVL
ATPSVRKFARDKSVDISQVNGSGKNGKITLEDVEAFLKGGSAAPAASAAPAAASAPAAAT
EAPKAKAAAPTASGNANLEEERVPFKGIRKAIANAMVKSAYTAPHVTIMDEVDVTELVAF
RARMKPVAEKKGVKVTYLPFIVKALVAASRQFPALNAMIDEATNEIVYKKYYNIGIATDT
DNGLIVPVIKDADRKSIWMIASAITDLAVRGRDGKLAPNEMKGSTISISNIGSAGGMFFT
PIINFPEVAILGTGRITEKPVVKNGEIVAAPVMALSLSFDHRIIDGATAQNFMNYIKTLL
ANPDMLVMEV
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
gtggcaaaatttgagtaccggttccctgagctgggcgaaggtctgcatgaaggcgaaatt
atcaaaatgcatatcaaagccggcgataaagtaaccgatgacgatatcgtaatggaagtt
cagaatgacaaggcagtagtagaggttccttgtccggttaacggcacagtgcttgaagtc
ttcaccaaagacggccaagtatgccgtgtgggtgaagtagtggcaattattgatgcagaa
ggcgaagttcctgaacaggaaggcggccatcctgcagaacaggcttcccaggaagcagat
gcagctaaaggcggagcagatacaacgtcatctccggcagccagcagccctgcaacaggc
ggaaccagtaactttgaatataagttccctgaactcggcgaaggtctgcatgaaggggaa
atcatcaagatgcacatcaaggtcggcgacaaaatcaccgacgatgatatcatcatggaa
gtgcagaatgataaggctgtagttgaagttccttctcctgtcaacggtaccgtagtagaa
gtgttcaccaaagacggtcaagtatgccgtgtaggcgaagtggtggcaatcattgctgca
gaaggcgatgttcctcagcaggaaggcggccatgcagaagcgtctggtgcacaggcagca
gctccttcccaggctccggcagcagcggcagcagctccggctcctaaccgtgaagtgctg
gcaacccctagcgtacgcaaatttgcccgtgataagagtgttgacatctctcaggtcaat
ggctccggcaagaacggcaagatcacacttgaagatgtagaagccttcctgaagggcgga
tcagcagcacctgcggcatcggcggctcctgcggcggcatctgcacctgcagcagcaaca
gaagctccaaaagctaaggcagcagcaccaacagcttccggcaatgcaaaccttgaagaa
gaacgcgtaccattcaagggtatccgtaaagccattgccaatgctatggttaaatcggca
tacacagcaccgcatgttaccattatggacgaagtggatgttacggagcttgtagccttc
cgcgcccgcatgaaacctgtagccgagaagaaaggcgtgaaggtaacttaccttccgttc
atcgtgaaggcactcgttgcagcttcccgtcaattccctgcgcttaacgctatgattgat
gaagcaacgaacgaaattgtctacaagaaatactacaacatcggtatcgctacagataca
gacaacggtctgatcgttcctgtaatcaaagacgctgaccgcaagagcatctggatgatc
gcaagcgcgattacagatctggcagtccgcggacgcgacggcaaactggctccgaatgaa
atgaaaggcagcaccatttcgatcagcaacatcggttccgcaggcggtatgttcttcacc
ccaattatcaacttccctgaagttgcaattctgggtacgggacgcatcactgagaagccg
gtcgttaagaatggcgaaatcgtcgctgctcctgttatggccttgtccttgagctttgac
caccgtattatcgatggtgcaaccgctcagaacttcatgaattacattaagaccctgctt
gcaaatcctgatatgttagttatggaggtgtaa

DBGET integrated database retrieval system