KEGG   Paenibacillus sp. FSL R5-0912: R50912_24775
Entry
R50912_24775      CDS       T03334                                 

Definition
(GenBank) sugar phosphorylase
  KO
K21350  sucrose 6(F)-phosphate phosphorylase [EC:2.4.1.329]
Organism
paeq  Paenibacillus sp. FSL R5-0912
Brite
KEGG Orthology (KO) [BR:paeq00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    R50912_24775
Enzymes [BR:paeq01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.329  sucrose 6F-phosphate phosphorylase
     R50912_24775
SSDB
Motif
Pfam: Alpha-amylase
Other DBs
NCBI-ProteinID: AIQ42894
UniProt: A0A089LDS4
LinkDB
Position
complement(5616617..5618083)
AA seq 488 aa
MTLKNQVQLITYPDSLGGDLKQLHQVLRGPFADLFAGGIHILPPFPSSGDRGFAPLTYLE
IEPEFGTWEDIRSIGEEFDVLVDLMVNHISRQSPYFQDFLEKGRASAYADLFITLDKIWA
DGQPVQADIEKMFLRRPLPYSTYSTPGSGEEKVWTTFGKTDPSEQIDLDIHSPLTRELLQ
RFFENFKAQNVKIVRLDAVGYVIKKLGTSCFFVEPEIYEFLDWIKAMADSLDIELLPEVH
AHYSIQNKLSEYGCWIYDFILPYRVLEALTGRSNKELYSYLQTRPHKQFTMLDCHDGVPV
KPDMDDLIDTKEAQKLVDLCVERGANLSLILSEEHKAPDGFDVHQIRCTYYSALNEDDDA
YLAARAIQFFAPGIPQVYYVGLLAGSNDLEQVALTGEGREINRHNYTLEEIEAETQREVV
QRLMKLIRFRNTYSAFGGTFRVLEAADHEIRLMWEHGGDYCRLFIDLQNYQTVIEYVDEQ
GQEAVYRV
NT seq 1467 nt   +upstreamnt  +downstreamnt
atgacactgaagaatcaagtccaattgattacctatcccgattcgctgggcggcgacctg
aagcagcttcatcaggtgctgcgcgggccgttcgcggatctgtttgcaggcggaattcat
attctgccgccctttccttcctccggggaccgcgggttcgctccgctgacttatctggag
attgagccggagttcggcacgtgggaggatatccgcagcataggggaagaattcgatgtg
ctggtagacctgatggtgaatcacatctccaggcaatcgccttatttccaggacttcctg
gagaaggggcgggcttccgcatatgccgatttattcattaccctggacaaaatatgggcg
gacggccagcctgtccaggcggatattgagaagatgttcctgcggcggcctctgccctat
tccacctactccaccccggggagcggggaagagaaggtctggacaacctttggcaaaact
gatccctccgagcaaattgatctcgatatccattcaccgctcacccgggagctgctgcag
cggttctttgagaatttcaaagcgcagaatgtcaagatcgtccggcttgatgcggtggga
tatgtgatcaagaagctgggcaccagctgtttttttgtggagccggagatttatgaattt
ctggactggatcaaagcgatggcggattcgctggatatagagctgctgcccgaggtacat
gcacattacagtatacagaacaagctatcggaatacggctgctggatctacgacttcatc
ctgccctaccgggtgcttgaggcactgaccggcagatccaataaggagctgtactcctat
ctgcagacccgcccgcataagcagttcacgatgctggattgtcacgacggcgttccggtg
aagccggatatggatgatctgattgatacgaaggaagcacagaagctggtggatctctgc
gtggagcggggggcgaacctgagcctgattctgtcggaggagcataaggctccggacggc
ttcgatgtccatcagatccgctgcacgtattacagcgcgctgaatgaagatgacgatgct
tatctggcggcccgggcgattcaattcttcgcaccgggtatcccgcaggtctattatgtg
ggcctgctggccggcagtaatgatctggagcaggtagccttgacgggtgaagggcgggag
atcaaccgccataactatacgctggaggagattgaagcagaaactcagcgggaggtggtg
cagcggctgatgaagctgattcgtttccgcaatacctacagtgccttcggaggaacgttc
cgggtgctggaggcggcagaccatgagatccggctgatgtgggagcatggcggagactac
tgccgactgttcattgacctgcagaattaccagactgtgattgaatatgtggatgagcaa
ggacaggaagcggtttaccgggtctaa

DBGET integrated database retrieval system