KEGG   Paenibacillus sp. FSL R5-0912: R50912_28240Help
Entry
R50912_28240      CDS       T03334                                 

Gene name
sdhB
Definition
(GenBank) succinate dehydrogenase
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
paeq  Paenibacillus sp. FSL R5-0912
Pathway
paeq00020  Citrate cycle (TCA cycle)
paeq00190  Oxidative phosphorylation
paeq00650  Butanoate metabolism
paeq01100  Metabolic pathways
paeq01110  Biosynthesis of secondary metabolites
paeq01120  Microbial metabolism in diverse environments
paeq01130  Biosynthesis of antibiotics
paeq01200  Carbon metabolism
Module
paeq_M00009  Citrate cycle (TCA cycle, Krebs cycle)
paeq_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:paeq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    R50912_28240 (sdhB)
   00650 Butanoate metabolism
    R50912_28240 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    R50912_28240 (sdhB)
Enzymes [BR:paeq01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     R50912_28240 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     R50912_28240 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_10 Fer4_9 Fer4_17 Fer4_7 Fer4_2 Fer4 Fer4_15 Fer4_13 Fer4_6 Fer4_3 Fer4_16 Fer4_4 Fer4_21
Motif
Other DBs
NCBI-ProteinID: AIQ43474
UniProt: A0A089LFF1
LinkDB All DBs
Position
complement(6450185..6450949)
Genome map
AA seq 254 aa AA seqDB search
MAETAAAPKNVKFIITRQDEPETNPYTEEFELAYRPGMNVISALMEIQRNPVNAKGDNTV
PVCWESNCLEEVCGACSMVINGKPRQACAALIDNLEQPVRIEPMKTFPVVRDLVIDRSRM
FNALKRVKAWIPIDGTYDLGPGPRMPEKKRQWAYELSKCMTCGVCLEACPNVNEKTNFIG
PAAISQVRLFNAHPTGEMNSDERLEALMEDGGIDGCGNSQNCVRACPKGIPLTTSIAEIN
KQTTKHMFKRWLGV
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaactgcagcagctcccaaaaacgtaaaatttatcattacccgccaagacgag
ccggaaacgaacccgtatacggaggagttcgagcttgcctaccgtccgggaatgaatgtg
atcagcgcgcttatggaaatccagcgcaatccggtgaacgcgaagggtgacaatacagtc
ccggtgtgctgggaatcgaactgtctggaggaagtatgcggcgcctgttccatggtgatc
aacggcaagccgcggcaggcctgcgcagcgctgatcgataacctggagcagccggtgcgc
attgagccgatgaagaccttccccgtggtccgtgacctggtgattgaccgcagccggatg
ttcaatgccctgaagcgggttaaggcctggattccgatcgacggcacgtatgacctgggt
ccgggaccccggatgccggagaagaagcgtcagtgggcttatgagttatccaagtgcatg
acctgcggtgtctgcctggaggcatgcccgaatgtcaatgagaagaccaatttcatcggt
cctgcggctatttcgcaggtgcgcctgttcaacgcccaccctacgggcgagatgaactct
gacgaacgtctggaagcgctgatggaagacggcggcatcgacggctgcggcaactcgcag
aactgcgtgcgcgcctgcccgaagggaattccgctgaccacctccattgccgagatcaat
aagcagacgactaagcatatgttcaagcgctggctgggcgtgtaa

DBGET integrated database retrieval system