KEGG   Paenibacillus sp. FSL R5-0912: R50912_28245Help
Entry
R50912_28245      CDS       T03334                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
paeq  Paenibacillus sp. FSL R5-0912
Pathway
paeq00020  Citrate cycle (TCA cycle)
paeq00190  Oxidative phosphorylation
paeq00650  Butanoate metabolism
paeq01100  Metabolic pathways
paeq01110  Biosynthesis of secondary metabolites
paeq01120  Microbial metabolism in diverse environments
paeq01130  Biosynthesis of antibiotics
paeq01200  Carbon metabolism
Module
paeq_M00009  Citrate cycle (TCA cycle, Krebs cycle)
paeq_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:paeq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    R50912_28245 (sdhA)
   00650 Butanoate metabolism
    R50912_28245 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    R50912_28245 (sdhA)
Enzymes [BR:paeq01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     R50912_28245 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     R50912_28245 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 HI0933_like FAD_oxidored GIDA NAD_binding_8 AlaDh_PNT_C DAO FAD_binding_3 CSN8_PSD8_EIF3K
Motif
Other DBs
NCBI-ProteinID: AIQ43475
UniProt: A0A089K6S5
LinkDB All DBs
Position
complement(6451313..6453055)
Genome map
AA seq 580 aa AA seqDB search
MASADIIIVGGGLAGLMATIKAAESGAHVHLFSLVPVKRSHSVCAQGGINGAVNTKGEGD
SPWEHFDDTVYGGDFLANQPPVKAMCEAAPGIIHLMDRMGVMFNRTPEGLLDFRRFGGTK
RHRTAFAGATTGQQLLYALDEQVRRWEAEGLVTKSENWEFLSVILDDERVCRGISAQNLK
TMEIQTFPADAVILASGGPGIIFGKTTNSVINTGTAASAVYQQGVHYANGEFIQIHPTAI
PGDDKLRLMSESARGEGGRIWTYKDGKPWYFLEEKYPSYGNLVPRDIATREIFNVCVDQG
LGINGENMVYLDLSHKDPKELDVKLGGIIEIYEKFMGDDPRKIPMKIFPAVHYSMGGMWV
DYNQMTNIPGLFAAGECEYQYHGANRLGANSLVSAIYGGMVSGPKAVEYIKGLKKSVQDI
SSTVFDSFHKTQEDKYESLLGMTGTENAYVIHKELGEWMTANMTVVRENKKLEATIGKIK
ELKERYGRINMSDTSRWSNQGVAFTRQLWNMLELSEAMTLGALLRNESRGAHYKPEFPTR
NDEEFLKTTKAAWTADGPQISYEEVDVSLIPPRVRDYSKD
NT seq 1743 nt NT seq  +upstreamnt  +downstreamnt
atggcatcagccgatattatcatcgtgggcggcggtctggccggcctgatggctaccatc
aaagccgccgaatccggcgcgcatgtacatctattctcactggtccctgtcaaaagatcg
cattcggtctgcgcgcaaggcggcatcaacggcgctgtgaatacaaagggcgagggcgac
tcgccctgggagcatttcgacgataccgtctacggcggcgacttcctggccaaccagcct
ccggtcaaagcgatgtgcgaagccgcaccgggcattattcacctgatggaccggatgggc
gttatgttcaaccgcacaccggaggggctgcttgatttccgccggttcggcgggacgaag
cgccaccggacagcgttcgccggagcgacaaccggccagcagctgctgtatgcgctggat
gagcaggtgcgccgctgggaagccgaaggcctggtgaccaaaagcgagaactgggagttc
ctctccgtcattctcgatgacgaacgcgtatgccgcggcatcagcgcccagaatctgaag
acgatggaaattcagaccttcccggcggatgcggtcattctggccagcggcggtccgggg
attattttcggcaaaacgacgaattcggtcatcaacacaggaaccgctgcaagcgctgta
tatcagcagggtgtgcattatgcgaacggggaattcatccagatccacccgacagccatc
ccgggcgatgacaagctgcggctgatgtcggaatcagcgcgcggagaaggcggacgtatc
tggacctataaggacggtaaaccgtggtatttcctcgaagagaaatatccctcttacggc
aatctggtgccgcgcgatatcgcaacacgtgagattttcaatgtgtgtgtggatcagggg
ctgggcattaacggcgagaacatggtgtacctggatctttcgcataaggacccgaaggag
ctcgacgtcaagctgggcggcattatcgagatctacgagaagttcatgggggatgatccc
cgcaaaattccgatgaaaatcttccccgctgtgcattattcgatgggcggcatgtgggtc
gactataaccagatgacgaatattcccggtctcttcgccgcaggggaatgtgaatatcaa
tatcacggggcgaaccgccttggagcaaattcgctggtatcggcgatctatggcggcatg
gtatcggggccgaaggctgtggaatatatcaaggggctcaagaagtcggttcaggatatc
tcctccacggtgtttgacagcttccacaagacgcaagaagacaaatatgagtctctgctg
gggatgacaggcacggagaatgcttacgtaatccacaaggagcttggcgaatggatgacg
gccaacatgaccgtggtgcgtgagaacaagaagctggaagcgaccatcggcaaaatcaaa
gagctaaaggaacgctacggccgcatcaacatgagcgatacttcacgctggagcaaccag
ggcgtagccttcacccgccagctgtggaatatgctggagctgtcagaagccatgaccctc
ggagcgctgctgcgcaacgagagccggggcgcgcattacaagccggagttccctacccgc
aatgatgaggaattcctcaagacgaccaaagccgcctggacggctgacggcccgcagatc
tcatatgaggaagtggatgtgtcgctgattcctccgcgggtgcgggattactcgaaggac
taa

DBGET integrated database retrieval system