KEGG   Paenibacillus sp. FSL R5-0912: R50912_28965Help
Entry
R50912_28965      CDS       T03334                                 

Definition
(GenBank) 6-phospho-beta-glucosidase
  KO
K01223  6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
paeq  Paenibacillus sp. FSL R5-0912
Pathway
paeq00010  Glycolysis / Gluconeogenesis
paeq00500  Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:paeq00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    R50912_28965
   00500 Starch and sucrose metabolism
    R50912_28965
Enzymes [BR:paeq01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     R50912_28965
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_1 Cellulase
Motif
Other DBs
NCBI-ProteinID: AIQ43600
UniProt: A0A089K727
LinkDB All DBs
Position
6617510..6618925
Genome map
AA seq 471 aa AA seqDB search
MSIKFPEGFLWGGAVAANQLEGAYNEDGKGWSTQDVAPQGIKGPITEVPTEDNMKLVGID
FYHRYKEDVKLFAEMGFKVFRTSIAWSRIFPNGDELEPNEQGLQFYDDLFDELHKYGIEP
LVTLSHYETPLHLSKHYNGWVNRDLVGFYERYARTVFTRYKNKVKYWLTFNEINSILHEP
FMSGGIYTPKEQLSKQDLYQAIHHELVASALAVKLSHEINPQAQIGCMILSMPTYPLTPN
PDDVIAAMKSEHMNYFFGDVHARGVYPGYMKRYFRENGIEIHMQPGDAEILKHTVDFISF
SYYVSICETGDNNKRNQNEANLFSGAANPYLKASEWGWQIDPQGLRYVLNMFHDRYQKPL
FIVENGLGAKDELITGEDGVPTVNDDYRIGYLNDHLVQVGEAIEDGVDVMGYTSWGCIDL
VSASTAQLSKRYGFIYVDRHDDNTGTLERYRKKSFHWYKDVIASNGESLLR
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgagtattaagtttcctgaaggctttctgtggggcggcgctgtagctgccaaccagctt
gaaggcgcatataatgaggacggcaaaggctggtcgacccaggacgtcgctccgcaaggg
atcaaaggtccgattactgaagttccgactgaggataatatgaagctggtcgggatcgac
ttttaccaccggtacaaagaggatgtgaagctttttgccgaaatgggcttcaaagtcttc
cgtacctccattgcctggtcgcggattttcccgaacggtgatgagctggagcctaatgag
caaggcctgcagttctatgatgatctgttcgacgaattgcataaatacggcatcgagccg
ctcgttaccctctcccactatgaaactccgctgcatttgtccaagcactataacggctgg
gttaaccgcgatttagtcggcttctacgaaaggtatgcgagaacggtattcacccgctac
aagaacaaagtgaaatattggctgacctttaacgagatcaactccattctgcatgaaccg
ttcatgagcggtggtatttacacgccgaaggagcagctcagcaagcaggatctgtatcag
gcaatccatcacgagctagtagccagtgcgctggccgtgaagctcagtcacgagattaac
ccgcaggcccagatcggctgtatgatccttagtatgccgacttatccgctcactccgaac
ccggatgatgtaatcgcagcgatgaagtcggagcatatgaactatttcttcggagatgtt
catgcgagaggcgtatatccgggctatatgaagcgttacttcagagagaacggtattgaa
atccatatgcagcctggcgatgccgagattctgaagcacacggtagacttcatctccttc
agctattatgtgagcatctgtgaaacgggagacaacaataagcgcaatcagaacgaagct
aacctgttcagcggtgcagccaatccctacctgaaggcttccgaatggggctggcagatt
gacccgcaaggtctgcgttatgtactgaacatgttccatgaccgttaccagaagccattg
tttattgtagaaaatggtctcggcgccaaggacgagctgatcaccggcgaagacggtgtg
ccgaccgtcaatgacgactaccggattgggtatttgaatgaccacctggtgcaggtgggt
gaagcaatcgaggacggcgtagatgtcatgggctacacctcatggggctgtattgacctg
gtcagcgcttcaaccgcacagctcagcaaacgttacggcttcatttatgttgaccgccac
gacgacaataccggcacacttgagcgctaccgcaaaaaatccttccactggtataaggac
gttattgcgtccaatggagagagtttgctgcgttaa

DBGET integrated database retrieval system