KEGG   Paenibacillus sp. FSL R5-0912: R50912_29560Help
Entry
R50912_29560      CDS       T03334                                 

Definition
(GenBank) glutamyl-tRNA amidotransferase
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
paeq  Paenibacillus sp. FSL R5-0912
Pathway
paeq00970  Aminoacyl-tRNA biosynthesis
paeq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:paeq00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    R50912_29560
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:paeq03029]
    R50912_29560
Enzymes [BR:paeq01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     R50912_29560
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     R50912_29560
Mitochondrial biogenesis [BR:paeq03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    R50912_29560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-ProteinID: AIQ43685
UniProt: A0A089K7A1
LinkDB All DBs
Position
complement(6734996..6736441)
Genome map
AA seq 481 aa AA seqDB search
MRLSMSKYETVIGLEVHVELHTKSKIFCGCSTEFGAPPNTHTCPVCLGHPGVLPVLNRQA
VEYAMKAAMALNCTIGDVSKFDRKNYFYPDSPKAYQISQFDQPIGLNGWIDIEVNGETKR
IGITRLHLEEDAGKLTHVDGGFASLVDFNRVGTPLIEIVSEPDLRSPEEARAYLEKIRAI
MQYCDVSDVKMEEGSMRCDANISLRPEGQEEFGIRAELKNMNSFRGVLRGLEYEQFRQGE
ILDDGGIVVQETRRWDEAGGKTLSMRGKEEAHDYRYFPDPDLIVLHISESWKEQIRATIP
ELPDARQARYSEEFGLTPYDAGVLTSSKPLADFFEGSLAYTQDAKAVANWMMGDLLGYLN
SNNLELSQVKITPQGLGEMIGLIAGGTISSKIAKTVFKEMLESGKLPTVIVEEQGLVQIS
DEGAIKKIVQDVIAANPQSVEDYKAGKKQAIGFLVGQVMKESKGKANPGLVNTLLADVLN
S
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgagattatctatgtctaaatatgaaacggtcattgggctggaagttcatgtggagctt
cataccaagtccaaaatcttctgcgggtgctccacagaattcggcgctccgcccaataca
catacctgtccggtctgtctcggccaccccggtgtattgccggttcttaaccgccaggcc
gtagagtacgcgatgaaagccgcaatggcgcttaactgtacgattggcgatgtcagcaaa
ttcgaccgcaaaaactatttttaccccgattccccgaaggcctaccagatttcgcaattt
gaccagcctatcggcctgaacggctggattgatattgaagtgaatggagagaccaaacgg
atcgggatcacccgtcttcatctggaggaagatgccggtaagctgactcatgtggacggt
ggatttgcttcattggttgacttcaaccgggtgggtactccgcttattgagattgtctca
gagcctgatctgcgttcgcccgaagaggcgcgtgcttatctggagaaaatccgcgccatt
atgcagtactgcgatgtatccgatgtgaagatggaagagggctcgatgcgctgcgatgcc
aatatcagcctgcggccggaaggccaggaggaattcggcatccgggcagagctgaagaac
atgaactccttccgcggcgtactccgaggtttggagtatgagcagttccgtcaaggcgag
attctggacgacggggggatcgttgtgcaggagacccgccgctgggatgaagctggaggc
aagaccttgtctatgcgcggtaaagaagaagcgcatgactaccgttatttcccggatccg
gatcttatcgtgctgcatattagcgagtcttggaaggaacagatccgtgccaccattccg
gagcttccggatgcccggcaggcccgttacagtgaagaatttggcctgactccctatgat
gccggagtgcttacctcatccaaaccgctcgctgatttctttgagggcagtctggcctac
acccaggatgccaaagctgtcgctaactggatgatgggagacctgctgggatatttaaat
agcaataatctggaattatcccaggtgaagattacgccgcaggggctgggtgagatgatc
ggcctgatcgcaggcggaaccatcagcagcaaaattgccaagaccgtcttcaaagaaatg
ctggaaagcggtaagctgccgacagttattgttgaagagcaggggctggtccagatcagt
gatgaaggggcaatcaaaaaaattgtccaggatgtgatcgctgctaatccgcaatctgtc
gaagactacaaggccggcaagaaacaagcgatcggcttcctcgtgggccaggttatgaaa
gaaagcaaaggaaaagcaaaccccggtcttgttaacacactgctcgctgacgtattgaac
agctag

DBGET integrated database retrieval system