KEGG   Paenibacillus sp. FSL R5-0912: R50912_30365Help
Entry
R50912_30365      CDS       T03334                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
paeq  Paenibacillus sp. FSL R5-0912
Pathway
paeq00620  Pyruvate metabolism
paeq00680  Methane metabolism
paeq01100  Metabolic pathways
paeq01120  Microbial metabolism in diverse environments
paeq01200  Carbon metabolism
Module
paeq_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:paeq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    R50912_30365
  09102 Energy metabolism
   00680 Methane metabolism
    R50912_30365
Enzymes [BR:paeq01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     R50912_30365
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 OTCace
Motif
Other DBs
NCBI-ProteinID: AIQ43824
UniProt: A0A089LGF7
LinkDB All DBs
Position
complement(6929140..6931932)
Genome map
AA seq 930 aa AA seqDB search
MTELTTTVSKSNSNNLLRRDVRFLGNILGEVLVHQGGNELLDIVEKIRETSKSLRSLFLP
ELHNEFKELISSLDTENRHQVIRAFAIYFQLVNIAEQNHRIRRKRDYERSAGETVQPGSI
ESAIQELRERDFSHEDVHEIMNGLSLELVMTAHPTEAMRRAILDIHKRISDDVMGLDNPT
LTFREREQLREKLLNEVITLWQTDELRDRKPTVLDEVRNGMYYFHETIFEVLPDVYQELE
RCLSKYYPGQNWHVPTYLRFGSWIGGDRDGNPSVTAAVTMQTLRLQRKLAIREYQRIMRE
LMQYLSFSTSIVNVTPELLESIEKDRNIINLNRVDAWRNDNEPYRIKLSYMISKTQNVLD
DEKKGTPVRYSSPEQFIDDLNVIDRSLRHHYADYVADTYIKKLIRQVELFGFHTSTLDVR
QHSQEHENAMTEILAKMNVTPDYSKLEEKQKIELLEKLLNDPRPLTSPYQSYSEGTEECL
AVYRTIFQAQEEYGKQCITSYLISMAEAASDILEVMVFSKEVGLFRKDNDGTVVCTLQAV
PLFETIDDLHEAPQIMHTLLSMPIYRDAVTAMNDLQEIMLGYSDSNKDGGVVTANWELRV
ALKQITATADEFGIKLKFFHGRGGALGRGGMPLNRSILAQPASTIGGGIKITEQGEVISS
RYSMKGIAYRSLEQATSALVTAAIHARSPQADLYEAKWDEIIARISEVSLNKYQDLIFRD
PDFLTYFKESTPLPEVGELNIGSRPSKRKNSERFEDLRAIPWVFAWTQSRYLLPAWYAAG
TGLQSFYEDKEENLKIMQHMYANFSFFTTLIDTLQMAIAKADLVIAKEYAGMGKNEEARQ
RIFGQIEAEFKLTSELILKITGQQDILDNVPVIQESIRLRNPYVDPLSYLQVQLLAELRA
LRDVEGDDAELLREVLLTINGIAAGLRNTG
NT seq 2793 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaacttacgactaccgttagcaaaagcaactccaataatctgctgcggcgggac
gtacggttcttggggaatattctgggcgaagtcttggtacaccaaggtggcaacgaactg
ctggatatcgtggagaagatccgtgaaaccagtaaatcgctgcgctcattgtttttgcct
gaactgcacaatgaatttaaagagctaattagttcactggatacggagaaccggcatcag
gtgatacgggctttcgccatttattttcaattagtgaacatagccgagcagaatcaccgg
attcgccgtaagcgcgattatgaacgttctgccggggagaccgtacagccagggtcgatt
gaaagcgcgattcaggagctccgcgagcgggatttctcccacgaggatgttcatgagatt
atgaacggcctgtctctggaactagttatgacggctcaccctacggaagctatgcgccgt
gcgatcctcgatatccacaaacggatctccgatgatgtcatgggactggataatccgact
ctgacgttccgcgaacgcgaacagctccgtgagaagctgctgaatgaagtgattacactg
tggcagacggatgagttgcgcgaccgtaagcctactgtgctcgatgaagtgcgcaatggc
atgtactatttccatgagacgatttttgaagtgctgccggatgtctatcaagaacttgag
cgatgtttgagtaagtactatcctggccagaactggcatgtgccaacttatcttcgtttc
ggttcatggattggcggcgaccgcgacggtaacccttccgtgacagcagccgtaactatg
cagacgctgcgtctgcagcgcaaactggccattcgtgagtatcagcggattatgcgcgaa
ttgatgcagtacctaagctttagtacaagcatcgtcaatgtgacgccggagctgctggag
tccattgagaaggaccgtaatattatcaatcttaaccgggttgatgcctggcgtaatgat
aatgaaccataccggattaagctcagctatatgatctccaagacacagaatgttctggac
gatgagaaaaaaggcacgcctgtgcgctactcctcaccagagcaatttatagatgatttg
aacgtgattgatcgcagcctgcggcatcactatgctgattatgtagcagacacctacatt
aagaagctaatccgccaggtggagctgttcggcttccatacgtcaaccctggacgtccgc
cagcacagccaggagcatgagaatgcgatgacggagattctggccaaaatgaatgttaca
ccggactactccaagcttgaggagaaacaaaagattgagctgctcgaaaagctgctgaat
gatccgcgtccgctgacatctccttaccagtcttatagtgaaggtacggaggagtgcctt
gcggtataccggacaatcttccaggcccaggaggaatacggcaaacagtgtatcacaagc
tatctgatcagtatggcggaggcagccagtgatattcttgaagtcatggtattctccaaa
gaagtgggactgttccgcaaagacaacgacggtacggtggtttgtactttgcaggcggta
ccgctgtttgaaaccattgacgaccttcatgaggcaccgcagattatgcatacgctgctc
agcatgccgatctaccgcgatgccgttactgcgatgaatgacctgcaggaaatcatgctt
ggttattcggacagtaataaggacggtggcgtggttacggcgaactgggagctgcgcgtt
gccctgaagcagattacagcgacagccgatgaattcggcattaagctgaaattcttccac
ggacgcggcggagccctcggacgtggcggtatgccgctgaaccggagtattctggcccag
ccggcttccaccattggcggcggtatcaagattaccgagcagggggaggtgatctcttcc
cggtattcgatgaaaggcattgcttaccgcagtctggagcaggcgacatctgctctggtt
acggcagccattcatgccagatcgccacaggcggatctgtatgaagcgaaatgggatgag
attattgcgcgcatctctgaagtctccctgaacaaatatcaggatctgatcttccgtgat
ccagatttcctgacgtacttcaaagaatcaaccccgctgccggaggttggggaactgaat
atcggttcacgtccttcgaagcgtaagaacagtgaacgcttcgaggatctgcgtgccatc
ccttgggtattcgcctggacgcagagccgttatctgctgcctgcatggtatgcggccgga
acaggactgcagagcttctatgaggataaagaagagaatttgaagatcatgcagcatatg
tatgccaacttctctttcttcacgaccttgatcgataccctgcagatggctattgccaag
gcggatctcgtaatcgccaaggaatatgccggcatgggcaaaaacgaagaggcgcgtcag
cggatcttcggccagattgaagccgaattcaagctgacctccgagctgatcctgaagatt
accggtcagcaggacattctggataatgttccggttattcaggaatcgatccgcctgcgt
aacccgtatgttgatccgctcagctacctgcaggttcagctccttgccgagcttcgcgcc
ctgcgcgatgtggagggcgatgacgctgagctgctgcgcgaggtactgcttaccatcaac
ggtattgccgccggtctccggaataccggctga

DBGET integrated database retrieval system