KEGG   Pseudomonas aeruginosa PA1R: PA1R_gp0066
Entry
PA1R_gp0066       CDS       T02929                                 

Definition
(GenBank) Gluconate 2-dehydrogenase
  KO
K06151  gluconate 2-dehydrogenase alpha chain [EC:1.1.99.3]
Organism
paer  Pseudomonas aeruginosa PA1R
Pathway
paer00030  Pentose phosphate pathway
paer01100  Metabolic pathways
paer01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:paer00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    PA1R_gp0066
Enzymes [BR:paer01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.99  With unknown physiological acceptors
    1.1.99.3  gluconate 2-dehydrogenase (acceptor)
     PA1R_gp0066
SSDB
Motif
Pfam: GMC_oxred_C GMC_oxred_N FAD_binding_3 DAO Pyr_redox_2 2-Hacid_dh_C
Other DBs
NCBI-ProteinID: AHA21843
LinkDB
Position
79443..81224
AA seq 593 aa
MNMATTLKPVDAVVVGFGWTGAILAKELTEAGLNVVALERGENRDTYPDGAYPNTLDELT
YNTRGKLFQNLSKSTVSIRHGINDTALPYRQLSAFLPGDGVGGAGLHWSGVHFRIMPEEL
RLRSHYEERYGKKFIPEGMTIQDYGVSYEELEPHFDFAEKVFGTSGTAHTVKGQVVGKGN
PFAADRSDDFPLPALRQVYSAQLFRKAAEELGLHPYDLPAANASGPWTNPYGVQMGPCNF
CGFCSGYACYMYSKASPNLNILPALRQTPLFELRANCNVLKVNLDSDGRQATGVTYVDAQ
GREIVQPAKLVIISAFQFHNVRLLLLSGIGKPYDPRTGEGVVGKNFAYQNMATIKAFFDK
DVHTNPFVGTGGGGVAVDDFNADNFDHGPLGFVGGSPMWVNQAGSKPIGGLAVPPGTPSW
GSGWKQAVKDAYTHTVSMDAHGSNMTYRDNYLDLDPTYKDAYGQPLLRMTFDWKDNEIRM
SRYVTEHMRKIAEAMNPKAISVSVKNFGDHFNTRVYQTTHLLGGAIMGSDPKTSVLNRYL
QSWDVHNVFVMGASAFPQGTGYNPTGLVAALAYWSAKAIREQYLKNPGPLVQA
NT seq 1782 nt   +upstreamnt  +downstreamnt
ttgaacatggcgacgacactcaaaccggtggacgcggtggtggtcggcttcggctggacc
ggagcgatcctggccaaggagctgaccgaggccgggctcaacgtggtggcgctggagcgc
ggcgagaaccgcgatacctatcccgacggcgcctacccgaacaccctcgacgagctgacc
tacaacacacgcggcaagctgttccagaatctctccaagagcaccgtgagcatccgccac
gggatcaacgacaccgcgctgccctaccgtcagctctccgccttccttcccggcgacggc
gtcggtggcgccggcctgcactggtccggcgtgcatttccggatcatgcccgaggaactg
cgcctgcgcagccattacgaggaacgctacggcaagaaattcatccccgaaggcatgacc
atccaggactacggggtcagctacgaagagctggagccacacttcgatttcgccgagaag
gtcttcggcacctccggcaccgcgcatacggtcaagggccaggtggtcggcaagggcaat
ccgttcgccgccgaccgctcggacgacttcccgctgccggcgctgcgccaggtgtactcc
gcgcaactgttccgcaaggccgccgaggaactcggcctgcacccctacgacctgccggcg
gccaacgcttcggggccctggaccaacccctacggggtgcagatggggccgtgcaacttc
tgcggcttctgcagcggctacgcctgctacatgtattccaaggcctcgccgaacctgaac
atcctgccggcgctgcgccagaccccgctgttcgaactgcgcgccaactgcaacgtgctc
aaggtcaacctcgacagcgacggcaggcaggccaccggcgtgacctacgtcgacgcccag
gggcgcgagatcgtgcagccggcgaagctggtgatcatcagcgccttccagttccacaac
gtgcgcctgctgctgctctccggcatcggcaagccctacgacccgcgcaccggcgagggc
gtggtgggaaagaacttcgcctaccagaacatggccaccatcaaggcgttcttcgacaag
gacgtgcataccaaccccttcgtcggcaccggcggcggcggcgtggcggtggacgacttc
aacgccgacaacttcgaccacggaccgctgggcttcgtcggcggctcgccgatgtgggtc
aaccaggccggctccaagccgatcggcggcctcgccgtgccgcccggcacgccgagctgg
ggcagcggctggaaacaggcggtcaaggacgcctacacgcacaccgtgtcgatggacgcc
cacggcagcaacatgacctaccgcgacaactacctcgacctcgacccgacctacaaggac
gcctacggccagccactgctgcgcatgaccttcgactggaaggacaacgagatccgcatg
agccgctacgtcaccgagcacatgcgcaagatcgccgaggcgatgaacccgaaggccatc
tcggtgagcgtcaagaacttcggcgaccacttcaatacacgggtctaccagaccacccac
ctgctcggcggggcgatcatgggcagcgatccgaagaccagcgtgctcaaccgctacctg
cagagctgggacgtgcacaacgtcttcgtcatgggcgcctcggccttcccccagggcacc
ggctacaaccccacagggctggtggcggcgctggcctactggtcggccaaggcgatccgc
gagcaatacctgaagaaccccggtccgctggtgcaggcatga

DBGET integrated database retrieval system