KEGG   Pseudomonas aeruginosa PA1R: PA1R_gp0226Help
Entry
PA1R_gp0226       CDS       T02929                                 

Definition
(GenBank) Pyoverdine chromophore precursor synthetase PvdL
Organism
paer  Pseudomonas aeruginosa PA1R
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Condensation AMP-binding PP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: AHA22003
LinkDB All DBs
Position
complement(291159..304187)
Genome map
AA seq 4342 aa AA seqDB search
MMDAFELPTTLVQALRRRAVQEPERLALRFLAEDDGEGVVLSYRDLDLRARSIAAALQAH
AQLGDRAVLLFPSGPDYVAAFFGCLYAGVIAVPAYPPESARRHHQERLLSIIADAEPRLV
LTTADLREPLLQMNAQLSAANAPQLLCVDQLDPAVAEAWDEPQVRPEHIAFLQYTSGSTA
LPKGVQVSHGNLVANEVLIRRGFGIGADDVIVSWLPLYHDMGLIGGLLQPIFSGVPCVLM
SPRYFLERPVRWLEAISQYGGTVSGGPDFAYRLCSERVAESALQRLDLSGWRVAFSGSEP
IRQDSLERFAEKFAASRFDASSFFACYGLAEATLFVTGGQRGQGIPALAVDGEALARNRI
AEGEGSVLMCCGRSQPEHAVLIVDAASGEVLGDDNVGEIWAAGPSIAHGYWRNPEASAKT
FVERDGRTWLRTGDLGFLRDGELFVTGRLKDMLIVRGHNLYPQDIERTVESEVPSARKGR
VAAFAVTVDGEEGIGIAAEIGRGVQKSVPAQELIDSIRQAVAEAYQEAPKVVALLNPGAL
PKTSSGKLQRSACRLRLEDGSLDSYALFPGLQAVQEAQSPAGDDELLARIGEIWKARLGV
AQVAPRDHFFLLGGNSIGAAQVVAQVRDSLGVALDLRQLFEAPTLQAFSATVARQLAAGL
PAEAPMAHLPRGVDLPQSAAQQRLWLTWQIDPQSAAYNIPGGLRLRGELDEAALRASFQR
LVERHEALRTRFLERDGAALQRIDERGEFAWQFVDLAALAEHERAAAAAQRREAEAQQPF
DLEKGPLLRVSLVRLDEQEHQLWVTLHHIVADGWSLNLLLDEFSRLYAEACGGQPADLAP
LELHYAEFAAWQRQWLDAGEGARQLAYWRERLGDTAPVLELATDHPRTARQASPAARYSL
RVDEALARAIREAALDHEASVFMWLLAAFQALLHRHSGQGEIRIGVPSANRQRLETQGLV
GFFINTLVLRGTPRARQPFAALLGEAREATLGAQANQDLPFDQVLAACGQGGQLFQVLFN
HQQRDLSALRRLPGLLADELPWHSREAKFDLQLQSEEDARGRLTLNFDYAADLFDEASIR
RFAAQYLELLRQVAEDPQRCLGDIALVDAEQAARLAEWGSAPCEPARAWLPELLEWQLAQ
SAERVAVEWDGGSLGYAELHAQANRLAHYLRDKGVGPDVRVAICAERSPQLLVGLLAIVK
AGGAYVPLDPDYPSERLAYMLADSGVELLLTQAHLFERLPGAEGVTPICLDSLKLDNWPS
QAPGLHLHGDNLAYVIYTSGSTGQPKGVGNTHAALAERLQWMQATYALDGDDVLMQKAPV
SFDVSVWECFWPLVTGCRLVLAAPGEHRDPARLVELVRQFGVTTLHFVPPLLQLFIDEPG
VAACGSLRRLFSGGEALPAELRNRVLQRLPAVALHNRYGPTETAINVTHWQCRAEDGERS
PIGRPLGNVVCRVLDAEFNLLPAGVAGELCIGGLGLARGYLGRPALSAERFVADPFSAAG
ERLYRTGDRARWNADGVLEYLGRLDQQVKLRGFRIEPEEIQARLLAQPGVAQAVVVIREG
VAGSQLVGYYTGAVGAEAEAEQNQRLRAALQAELPEYMVPAQLMRLAQMPLGPSGKLDTR
ALPEPVWQQREHVEPRTELQRRIAVIWSEVLGLPRVGLRDDFFELGGHSLLATRIVSRTR
QACDVELPLRALFEASELEAFCEQVRAAQAAGRTDSHGAIRRIDREQPVPLSYSQQRMWF
LWQLEPDSPAYNVGGLARLSGPLDVARFEAALQALVQRHETLRTTFPSVDGVPVQRVHGD
GGLHMDWQDFSALDRDSRQQHLQTLADSEAHRPFDLESGPLLRVCMVKMAEREHYLVVTL
HHIVTEGWAMDIFARELGALYEAFLDDRESPLEPLPVQYLDYSVWQREWLESGERQRQLD
YWKAQLGNEHPLLELPGDRPRPPVQSHQGDLYRFDLSPELAERVRRFNAARGLTMFMTMT
ATLAALLYRYSGQQDLRIGAPVANRIRPESEGLIGAFLNTQVLRCRLDGQMSVGELLEQV
RQTVIDGQSHQDLPFDHLVEALQPPRSAAYNPLFQVMCNVQRWEFQQTRQLAGMTVEYIA
NDARATKFDLNLEVTDLDQRLGCCLTYSRDLFDEPRIARMAGHWQNLLEALLGDPQRRIA
ELPLFAAEERKQLLLAGTAGEAGLQDTLHGLFAARVAASPQAPALTFAGQTLSYAELDAR
SNRLARVLRGHGVGPEVRVGLALERSLEMVVGLLAILKAGGAYVPLDPEYPLERLQYMIE
DSGVRLLLSHAALFEALGELPAGVARWCLEEDGPALDAEDPAPLAALSGPQHQAYLIYTS
GSTGKPKGVAVSHGEIAMHCAAVIERFGMRAEDCELHFYSINFDAASERLLAPLLCGARV
VLRAQGQWGAEEICELIRAEGVSILGFTPSYGSQLAQWLESQGRQLPVRMCITGGEALTG
EHLQRIRQAFAPASFFNAYGPTETVVMPLACLAPERLEEGAASVPIGSVVGARVAYILDA
DLALVPQGATGELYVGGAGLARGYHERPALSAERFVPDPFAAEGGRLYRTGDLVRLCDNG
QVEYVGRIDHQVKIRGFRIELGEIEARLLEHPQVREALVLALDSPSGKQLAGYVASAVAE
QDEDAQAALREALKTHLKQQLPDYMVPAHLLLLASLPLTANGKLDRRALPAPDPALNRQA
YEAPRSVLEQQLAGVWREVLNVERVGLGDNFFELGGDSILSIQVVSRARQLGIHFSPRDL
FQHQTVQSLAAVARHSQASQAEQGPVQGDSALTPIQHWFFDLPLARREHWNQSLLLQPRQ
ALDLGLLRKSLQRLVEQHDALRLAFRQVDGEWLAQHRPLREQELLWHVPVQSFDECAELF
AKAQRSLDLEQGPLLRAVLVDGPAGEQRLLLAIHHLAVDGVSWRVLLEDLQQVYRQLDEG
AEPALPAKTSAFRDWAGRLQAYAGSESLREELGWWQARLGGQSAEWPCDRPRGDNREALA
ESVSLRLDPQRTRQLLQQAPAAYRTQVNDLLLTALARVLCRWSGQPSTLVQLEGHGREAL
FDDIDLTRSVGWFTSAYPLRLTPAQSPGESIKAIKEQLRAVPHKGLGYGVLRYLADPAVR
QAMAALPTAPITFNYLGQFDQSFADALFQPLDQPTGPIHDEQAPLPNELSVDGQVYGGEL
VLRWTYSRERYDAQTVNELAQAYLAELQALIEHCLEDGAGGLTPSDFPLAQLSQAQLDAL
AVPAGEIEDVYPLTPMQEGLLLHTLLEPGTGIYYMQDRYRIDSPLDPERFAAAWQAVVAR
HEALRASFVWNAGETMLQVIHKPGRTRIEFLDWSELPEDGHEERLQALHKREREAGFDLL
EQPPFHLRLIRLGEARYWFMMSNHHILIDAWCRGLLMNDFFEIYSALGESRPANLPTPPR
YRDYIAWLQRQDLEQSRRWWSESLRGFERPTLVPSDRPFLREHAGESGGMIVGDRYTRLD
AADGARLRELAQRYQLTVNTFAQAAWALTLRRFSGERDVLFGVTVAGRPVGMPEMQRTVG
LFINSIPLRVQMPAAGQRCTVREWLNRLFERNLELREHEHLPLVAIQESSELPKGQPLFD
SLFVFENAPVEVSVLDRAQSLNASSDSGRTHTNFPLTVVCYPGDDLGLHLSYDQRYFEAP
TVERLLGEFKRLLLALADGFHGELEALPLLGEDERDFLLDGCNRSARDYPLEQGYVRLFE
AQVAAHPQRIAASCLEQRWSYAELNRRANRLGHALRAAGVGIDQPVALLAERGLDLLGMI
VGSFKAGAGYLPLDHGHPTQRLTRIVELSRTPVLVCTQACREQALALFDELGCVDRPRLL
VWDEIQQGEGAEHDPQVYSGPQNLAYVIYTSGSTGLPKGVMVEQAGMLNNQLSKVPYLEL
DENDVIAQTASQSFDISVWQFLAAPLFGARVAIVPNAIAHDPQGLLAHVGEQGITVLESV
PSLIQGMLAEERQALDGLRWMLPTGEAMPPELARQWLKRYPRIGLVNAYGPAECSDDVAF
FRVDLASTESTYLPIGSPTDNNRLYLLGAGADDAFELVPLGAVGELCVAGTGVGRGYVGD
PLRTAQAFVPHPFGAPGERLYRTGDLARRRADGLLEYVGRIDHQVKIRGFRIELGEIEAR
LHERADVREAAVAVQEGANGKYLVGYLVPGETQRSSADSPAGLMVEQGAWFERIKQQLRA
DLPDYMVPLHWLVLDRMPLNANGKLDRKALPALDIGQMQNQAYQAPRNELEETLARIWAE
VLKVERVGVFDNFFELGGHSLLATQIASRVQKALQRNVPLRAMFECTTVEELASYIESLA
PSEISEQKAERLNDLMSKLEML
NT seq 13029 nt NT seq  +upstreamnt  +downstreamnt
atgatggacgccttcgaacttcccaccaccctggtccaggccctgcgtcgccgcgctgtc
caggagcccgagcgcctggcgctgcgcttcctcgccgaggacgatggcgaaggcgtggtc
ctcagctatcgcgatctcgacctgcgcgcgcggagcatcgccgcggccctgcaggcccat
gcgcagctgggcgatcgcgcggtactgctgtttcccagcggccccgactacgtcgcggcg
ttcttcggttgcctgtatgccggggtcatcgcggtgccggcctacccgccggaatcggcg
cgccgccatcaccaggaacgcctgttgtcgatcatcgccgacgccgagccgcgcctggtc
ctgaccaccgctgacctgcgcgagccattgctgcagatgaacgcgcaactgtccgccgcc
aacgccccgcaactgctctgcgtcgaccagttggacccggccgttgccgaggcctgggac
gagccgcaagtgcgtcccgagcacatcgccttcctccagtacacctccggttcaaccgca
ttgcccaagggcgtgcaggtcagccatggcaacctggtcgccaacgaggtgctgatccgc
cgaggcttcggcatcggtgccgacgacgtgatcgtcagctggctgccgctgtaccacgac
atgggcctgatcggcggcctgctgcaaccgatcttcagcggcgtaccctgcgtgctgatg
tcgccgcgctacttcctcgaacgtccggtgcgctggctggaagccatcagccagtacggc
ggcaccgtcagcggcggtcccgatttcgcctaccggctgtgcagcgagcgggtcgccgag
tcggccctgcagcgtctcgacctgagcggttggcgggtagccttctccggttccgagccg
atccgccaggacagcctggaacgcttcgccgagaaattcgccgccagccgcttcgatgcg
tccagtttcttcgcctgctacggcctcgccgaggcgaccctgttcgtcaccggcggccag
cgcggccagggcattcccgccctggcggtggatggcgaggcgctggcgcgcaaccgcatc
gccgaaggcgaaggcagcgtgctgatgtgctgcggccgcagccagccggaacacgccgtg
ctgatcgtcgacgcggcgagcggcgaggtcctcggcgacgacaacgtcggcgagatctgg
gccgccgggccgagcatcgcccacggctactggcgcaacccggaagcttcggcgaagacc
ttcgtcgagcgtgacgggcgcacctggctgcgcaccggcgacctcggcttcctccgcgac
ggcgaactgttcgtcaccgggcgcctgaaggacatgctcatcgtccgcggccacaacctc
tatccgcaggacatcgaacgcaccgtcgagagcgaggtgccgtcggcgcgcaagggcagg
gtcgcggccttcgcggtcacggtcgatggcgaggaaggcatcggcatcgccgccgagatc
ggtcgcggcgtccagaaatcggtgccggcccaggagctgatcgactcgatccgccaggcg
gtggccgaggcctaccaggaagcgccgaaggtggtggcgctgctcaatcccggcgccttg
ccgaagacgtccagcggcaagctgcaacgttccgcctgccgcctgcgcctggaagacggc
agcctggacagctatgcgctgtttcccggcctccaggccgtgcaggaggcgcagtcgccg
gcaggcgacgacgaactgctggcacgcatcggcgagatctggaaggcccggctgggcgtg
gcgcaggtagcgccgcgcgatcacttcttcctgcttggcggcaattccatcggcgccgcc
caggtggtcgcccaggtgcgcgacagtctcggcgtcgccctcgacctgcgccaactgttc
gaggcgccgaccctgcaggccttcagcgccacggtggcccgccaactggccgccggcctg
ccggccgaggcaccgatggcgcacctgccgcgcggtgtcgacctgccgcagtcggcggcg
cagcagcgtctctggctgacctggcagatcgatccgcagagcgccgcctacaacatcccc
ggcggcctgcgcctgcgcggcgagctggacgaagcggcgctgcgcgccagcttccagcgc
ctggtcgaacgccacgaagcgctgcgcacgcgtttcctcgagcgcgacggcgcggccttg
cagcgtatcgacgagcggggcgagttcgcctggcagttcgtcgacctcgccgcgctggcc
gagcacgaacgcgccgcggctgccgcgcagcgccgcgaagccgaggcgcagcagccgttc
gacctggaaaaggggccgctgctgcgggtcagcctggtgcgcctggacgaacaggagcac
cagctctgggtcaccctgcatcacatcgtcgccgatggttggtcgctgaacctgctgctc
gacgaattctcgcggctctacgccgaagcctgcggcggccagccggccgacctggcgccg
ctggaactgcactacgccgagttcgctgcctggcaacggcagtggctggacgcgggcgag
ggcgcccgccaactggcctactggcgggagcgcctgggcgacacggcgccggtgctggaa
ctggccaccgaccatccgcgcacggcgcgccaggcgtcgcccgccgcgcgctacagcctg
cgggtcgacgaagccctggcgcgggctatccgcgaggccgcgctggaccatgaggcgagt
gtcttcatgtggctgctggcggcgttccaggcgctgctgcatcgccacagcgggcagggc
gagatccgcatcggcgtgcccagcgccaaccgccagcgcctggagacccaggggctggtc
ggcttcttcatcaacaccctggtcctgcgcggcacgccccgggcgcgccagccgttcgcc
gcgttgctcggcgaggctcgcgaggcgaccctcggcgcccaggccaaccaggacctgccg
ttcgaccaggtgctcgcagcctgcggccagggcggccagttgttccaggtgctgttcaac
caccagcagcgcgacctgtcggcgttgcgccggctgcccggcctgctcgccgacgagctg
ccctggcacagccgcgaagccaagttcgacctgcaactgcagagcgaggaggacgctcgc
ggtcgcctgaccctgaatttcgactacgccgcggacctcttcgacgaggccagcatccgg
cgtttcgccgcgcaatacctggagctgctgcgccaggtcgcggaagacccgcagcgctgc
ctcggcgatatcgccctggtcgacgccgagcaggcggcgcgcctcgccgaatggggcagc
gcgccctgcgagccggcgcgcgcctggctgccggagctgctggagtggcaactggcgcag
tccgccgaacgcgtcgccgtggagtgggacggcggcagcctcggctacgccgaactgcac
gcccaggccaaccgcctggcccactacctgcgcgacaagggcgtcggcccggacgtgcgg
gtagcgatctgcgccgagcgttcgccgcaactgctggtcggtctgctggcgatcgtcaag
gcgggcggcgcctacgtgccgctggacccggactaccccagcgaacgcctggcctacatg
ctcgccgacagcggcgtcgagttgctactgacccaggcccatctgttcgaacgcctgcct
ggcgcggagggcgtcacgccgatctgcctggacagcctcaagctcgacaactggccgagc
caggcaccgggcctgcacctgcacggcgacaatctcgcctacgtcatctacacctccggc
tccaccggccagccgaagggcgtgggcaacacccacgcggcgctggccgagcgcctgcag
tggatgcaggccacctacgccctcgacggcgacgacgtgctgatgcagaaggcgccggtg
agcttcgacgtgtcggtgtgggagtgcttctggccgctggtcaccggttgccggctggtc
ctcgccgcccccggcgagcaccgcgatccggcgcgcctggtggaactggtgcggcagttc
ggggtgaccacgctgcacttcgtgccgccgctgctgcaactgttcatcgacgaacccggc
gtcgccgcctgcggcagcctgcgccgcctgttctccggcggcgaggcgcttccggcggag
ctgcgcaaccgcgtgttgcaacgcctgccggcggtggccctgcataaccgctacgggccg
accgagaccgccatcaacgtcacccattggcagtgccgcgcggaagacggcgagcgttcg
ccgatcggccggccgctgggcaacgtggtctgccgcgtgctggacgccgagttcaacctg
ctgccggccggcgtcgccggcgagttgtgcatcggcggcctgggcctggcccgtggctac
ctggggcgcccggcgctgagcgccgagcgcttcgtcgccgatccgttctcggccgccggc
gagcgcctgtaccgcaccggcgaccgcgcgcgctggaacgccgacggcgtgctggaatac
ctcggccgcctcgaccagcaggtcaagctgcgtggcttccgcatcgagccggaggagatc
caggcacgcctgctggcgcagccgggggtggcccaggcggtggtggtgatccgcgaaggc
gtggccggcagccagttggtcggctactacaccggcgctgtcggcgccgaggcggaagcc
gagcagaaccagcgcctgcgcgccgcgctacaggccgaactgccggaatacatggtcccg
gcgcagttgatgcgcctggcgcagatgcccctcggcccgagcggcaagctggatacgcgg
gcgctgccggagccggtctggcagcagcgcgagcacgtcgagccgcggaccgagctgcaa
cggcgcatcgccgtgatctggagcgaagtgctcggcctgccgcgggtcggcttgcgcgac
gatttcttcgagctcggcgggcattccctgctggccacccgcatcgtctcgcgcacccgc
caggcctgcgacgtcgaactgccgttgcgcgcgctgttcgaggccagcgaactggaggcc
ttctgcgaacaggtccgcgcagcccaggccgccggacgtaccgacagccacggcgcgatc
cgccgcatcgaccgcgagcagccggtgccgctgtcctactcgcagcagcgcatgtggttc
ctctggcaactggagccggacagcccggcctacaacgtcggcggcctggcgcgcctgagc
gggccgctggacgtggcgcgcttcgaggccgcgctacaggccctggtgcagcgccacgag
accctgcgcaccacgttccccagcgtcgacggcgtgccggtacagcgcgtacatggcgat
ggcggcctgcacatggactggcaggacttctccgcgctcgaccgcgacagccgccagcag
cacctgcagaccctcgccgacagcgaggcgcaccggcccttcgatcttgagagcgggccg
ttgctgcgggtctgcatggtgaagatggccgagcgtgagcactacctggtggtgaccctg
caccacatcgtcaccgaaggctgggcgatggacatcttcgcccgcgaactgggcgcgctc
tacgaggccttcctcgacgaccgcgaatcgccgctggagccgttgccggtccagtacctg
gactacagcgtgtggcagcgcgagtggctggagagcggcgagcgccagcgccagctcgac
tactggaaggcccagctgggcaacgagcatccgctgctcgaactgccgggcgaccggcca
cgcccgccggtgcagagccaccagggcgacctctaccgcttcgacctgagccccgagctg
gccgagcgcgtgcgccgcttcaacgccgcccgcgggctgaccatgttcatgaccatgacc
gccacccttgcggccttgctctaccgctacagcggccagcaggacctgcgtatcggcgcg
ccggtggcgaaccgcatccgcccggagagcgaagggctgatcggcgccttcctcaatacc
caggtgctgcgctgccggctcgacggacagatgagcgtcggcgagctgcttgagcaggtg
cggcagaccgtgatcgatggccagtcgcaccaggacctgccgttcgaccacctggtggaa
gccctgcaaccgccgcgcagcgccgcctacaacccgttgttccaggtgatgtgcaacgtc
cagcgctgggagttccagcagacccggcaactggccgggatgaccgtcgagtacatcgcc
aacgatgcgcgggcgaccaagttcgacctcaaccttgaggtcaccgacctcgaccagcgc
ctcggctgctgcctgacctacagccgcgacctgttcgacgaaccgcgcatcgcgcggatg
gccggacactggcagaacctgctggaggcgctgctgggcgacccgcagcggcgcattgcc
gaattgccgctgttcgccgccgaggagcggaagcaactgctgctcgccggcacggccggc
gaggcagggctccaggacaccctccatggcctgttcgccgcccgcgtggcggccagcccc
caggccccggcgctgaccttcgccggacagaccctgagctatgccgaactcgacgcccgc
tccaaccgcctggcgcgcgtcctgcgcggtcatggcgtcggcccggaagtgcgggtcggc
ctggccctggagcgttcgctggagatggtcgtcggcctgctggcgatcctcaaggccggc
ggcgcctacgtgccgctggacccggaatatccgctggagcgcctgcaatacatgatcgag
gacagcggcgtacgcctgctgctcagccacgcggcgctgttcgaggccctcggcgagctg
ccggcgggcgtggcgcgctggtgcctcgaggaggacggcccggcgctggacgccgaggac
cccgcgccgctggcagcactgagcgggccgcagcaccaggcctacctgatctatacctcc
ggctccaccggcaagccgaagggcgtggcggtctcccacggcgagatcgccatgcactgc
gccgcggtgatcgagcgcttcggcatgcgcgccgaggattgtgaactgcacttctattcg
atcaacttcgacgccgccagcgagcgcctgctggccccgttgctgtgcggcgcccgcgtg
gtgctgcgggcccagggccagtggggcgcggaggaaatctgcgagctgatccgcgcggag
ggcgtgagcatcctcggcttcaccccgagctacggcagccagctcgcccagtggctggag
agccagggccggcagttgccggtgcgcatgtgcatcaccggcggcgaggcgctgaccggc
gagcacctgcagcggattcgccaggccttcgccccggcgtcgttcttcaatgcctacgga
ccgaccgagacggtggtcatgccgctggcctgcctggctcccgaacgcctggaggagggc
gccgccagcgtgccgatcggcagcgtggtcggtgcgcgggtcgcctacatcctggatgcc
gacctggccctggtgccgcagggcgcgaccggcgaactctacgtcggcggcgccggcctg
gcgcgcggctaccatgagcgtccggcgctcagcgccgagcgcttcgtgcccgatcccttc
gctgccgagggcggccgcctgtaccgcaccggcgacctggtgcgcctgtgcgataacggc
caggtggaatatgtcggccgcatcgaccaccaggtgaagatccgtggtttccgcatcgaa
ctgggcgagatcgaggcgcgcctgctggagcatccgcaggttcgcgaagcgctggtcctg
gcgctcgacagcccgagcggcaagcagttggccggttatgtcgccagcgcggtggccgag
caggacgaggacgcccaggcggcgctgcgcgaggcgctgaaaacgcacctcaagcagcaa
ttaccggactacatggtgccggcccacctgctgctgctcgccagcctgccgctgaccgcc
aacggcaagctcgaccgccgcgcgctgccggcgcccgacccggcgctcaaccggcaggcc
tacgaggccccgcgcagcgtgctggaacagcagttggccggggtttggcgcgaggtgctg
aacgtcgagcgggtaggcctcggcgacaacttcttcgaactgggcggcgattcgatcctg
tcgatccaggtggtcagccgcgcccgccagctcggcatccactttagcccccgcgacctg
ttccagcaccagaccgtgcagagcctcgccgcggtggcccggcacagccaggccagccag
gccgagcaggggccggtgcagggcgacagcgcgctgacgccgatccagcactggttcttc
gacctgccgctggcgcgccgcgagcactggaaccagtcgctgctgttgcagccgcggcag
gccctcgacctcggcctgctgcgcaagtccctgcaacgcctggtcgaacagcatgacgcc
ctgcgcctggcgttccgccaggtcgacggcgaatggctggcgcagcatcgtccgctgcgc
gaacaggaactgctctggcacgttccggtgcaatccttcgacgaatgcgccgagctgttc
gccaaggcccagcgcagcctcgacctcgaacagggtccgctgctgcgcgcggtgctggtg
gacggcccggccggtgagcaacgcctgctgctggcgatccaccacctggcggtggacggg
gtgtcctggcgggtgctgctggaggatctgcaacaggtctaccgtcagctcgacgagggc
gccgaaccggcgttgccggccaagaccagcgccttccgcgactgggccggacgcctgcag
gcctacgccggcagcgaatcgctgcgcgaagagctgggctggtggcaagcccggctgggc
gggcagtcggccgagtggccatgcgaccgcccgcggggcgacaaccgcgaggcgctggcg
gaaagtgtcagcctgcggctcgacccgcaacgtacccggcaattgctgcaacaggcgccg
gcggcctaccgcacccaggtcaacgacctgctgctgaccgccctcgctcgcgtgctctgc
cgctggagcgggcagccgtcgacgctggtgcagttggaagggcatggccgcgaggcactg
ttcgacgatatcgacctgacccgcagcgtcggctggttcaccagcgcctacccgttgcgc
ctgaccccggcgcagagcccgggcgagtcgatcaaggcgatcaaggaacagctccgcgcg
gtgccgcacaaaggcctcggctacggcgtgctgcgctacctcgccgatccggcggtgcgc
caggcgatggccgcgctgcccacggcgccgataaccttcaactacctcggacagttcgac
cagagcttcgccgacgccctgttccagccgctggaccagcccaccgggccgatccacgac
gagcaggcgccgttgcccaacgagctgagcgtcgatggccaggtctacggcggcgagctg
gtgctgcgctggacctacagccgcgagcgctacgacgcgcagacggtgaacgagctggcg
caggcctatctcgccgaactgcaggcgctgatcgagcattgcctggaagacggcgccggc
ggcctgaccccgtccgacttcccgctggcgcaactgagccaggcgcaactggacgccctg
gcggtgccggccggcgagatcgaggacgtctatccgctgaccccgatgcaggaagggttg
ctgttgcacaccctgctggaaccgggcaccggcatctactacatgcaggaccgctaccgg
atcgacagcccgctcgatcccgagcgcttcgccgccgcctggcaggcggtggtggcccgc
cacgaggcgctgcgcgcgtcgttcgtctggaatgctggcgaaacgatgttgcaggtgatc
cacaagcccggtcgcacccgcatcgagttcctcgactggagcgaactgccggaggacggc
cacgaggaacgcctgcaagcgctgcacaagcgcgagcgcgaggccggcttcgacctgctg
gaacagccgccgttccacctgcgcctgatccgcctgggcgaggcgcgctactggttcatg
atgagcaaccaccacatcctcatagatgcctggtgccgtggcctgctgatgaacgacttc
ttcgagatctacagtgctctcggcgaaagccgcccggcgaacctgccgacgccgccgcgc
taccgcgactacatcgcctggctgcaacgccaggacctggagcaatcgcgacgctggtgg
agcgagagcctgcgcggcttcgagcggccgaccctggtgcccagcgaccgcccgttcctc
cgcgagcacgccggcgagagcggcgggatgatcgtcggcgaccgctacacgcgtctggac
gccgccgacggcgcgcgcctgcgcgaactggcgcagcgctaccagctcaccgtcaacacc
ttcgcccaggccgcctgggcgctgaccctgcgccgcttcagcggcgagcgcgacgtgctc
ttcggcgtcaccgtggccgggcgtccggtgggcatgccggaaatgcagcgcaccgtcggc
ctgttcatcaacagcatcccattgcgcgtgcagatgccggccgccggccagcgctgcacg
gtacgcgaatggctgaaccggctgttcgagcgcaacctggagttgcgcgagcacgagcac
ctgcccctggtggccatccaggaaagcagcgagctgcccaagggccagccgctgttcgac
agcctgttcgtgttcgagaacgctccggtggaagtctcggtactggaccgcgcgcagagc
ctgaacgccagttccgactccgggcgtacccacaccaacttcccgttgaccgtggtctgc
tatccgggtgatgacctcggcctgcacctgtcctacgaccagcgctacttcgaggcgccg
accgtcgagcgcctgctcggcgagttcaagcgcctgctgctggccctggccgacggtttc
cacggcgaactggaggccttgccgctgctcggcgaggacgagcgcgacttcctcctcgac
ggctgcaaccgcagcgcccgcgactacccgctggagcaaggctacgtgcggctgttcgag
gcgcaggtggcagcccatccgcagcgcatcgccgccagttgcctggaacagcgctggagc
tacgccgagctgaaccgacgggccaaccgcctcggccacgccctgcgcgccgccggcgtc
ggcatcgaccagccggtggcactgctggccgagcgcggcctcgacctgctcggcatgatc
gtcggcagcttcaaggccggtgccggctacctgccgctcgaccacggccatccgacccag
cgcctgacccggatcgtcgagctgagccgcacgccggtgctggtctgcacccaggcctgc
cgcgagcaagcgctggcgctgttcgacgaactcggctgcgtcgaccggccgcgcctgctg
gtgtgggacgagatccagcagggcgagggcgccgagcacgatccgcaggtctacagcggg
ccgcagaacctcgcctacgtgatctacacctccggctccaccggactgccgaagggcgtg
atggtggagcaggcgggcatgctcaacaaccagttgagcaaggtcccgtacctggaactg
gacgagaacgacgtgatcgcccagaccgcctcgcagagcttcgacatctcggtctggcag
ttcctcgccgcgccgttgttcggcgcccgcgtggcgatcgtgccgaacgccatcgcccac
gatccgcagggcctgctggcgcacgtcggcgaacagggcatcacggtgctggaaagcgtg
ccgtcgctgatccagggcatgctcgccgaagagcgccaggccctcgacggcctgcgctgg
atgctgcccaccggcgaggcgatgccgccggaactggcgcgccagtggctcaagcgctac
ccgcggatcggcctggtgaatgcctacgggccggcggaatgctccgacgacgtggcgttc
ttccgcgtcgacctggcctccaccgagagcacctacctgccgatcggcagtcccaccgac
aacaaccgcctgtacctgctcggcgccggcgccgacgacgccttcgaactggtgccgctg
ggcgcggtgggcgagctgtgcgtggccggcaccggcgtcggtcgtggctacgtcggcgat
ccgctgcgcaccgcccaggccttcgtcccgcatccgttcggcgcgccgggcgagcgtctg
taccgtaccggcgacctggcgcggcggcgcgccgacggactgctggaatatgtcgggcgg
atcgaccaccaggtgaagatccgcggcttccgcatcgagctgggcgagatcgaggcgcgc
ctgcacgaacgcgccgacgtccgcgaggcggcggtggcggtgcaggaaggggcgaacggc
aagtacctggtgggctacctggttcccggcgagacacagcgttccagcgccgactcgccg
gccggactgatggtggagcagggcgcctggttcgagcggatcaagcagcaactgcgcgcc
gacctgccggactacatggtgccgctgcactggctggtgctggaccggatgccgctcaac
gccaacggcaagctcgaccgcaaggcgctgccggcgctggacatcggccagatgcagaac
caggcctaccaggccccgcgcaacgaactggaggaaaccctggcgcggatctgggccgag
gtgctgaaggtcgagcgggtcggggtgttcgacaacttcttcgaactcggcgggcattcg
ctgctggccacccagatcgcctcgcgggtgcagaaggccctgcaacgcaacgtgccgcta
cgggcgatgttcgaatgcaccacggtggaagagctggccagctacatcgagtccctggcc
ccgagcgagatcagcgagcagaaggccgagcgcctgaacgacctgatgtcgaagctggaa
atgctctga

DBGET integrated database retrieval system