KEGG   Pseudomonas aeruginosa PA1R: PA1R_gp1984Help
Entry
PA1R_gp1984       CDS       T02929                                 

Definition
(GenBank) 2,4'-dihydroxyacetophenone dioxygenase
  KO
K05913  2,4'-dihydroxyacetophenone dioxygenase [EC:1.13.11.41]
Organism
paer  Pseudomonas aeruginosa PA1R
Pathway
paer01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:paer00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00363 Bisphenol degradation
    PA1R_gp1984
Enzymes [BR:paer01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.41  2,4'-dihydroxyacetophenone dioxygenase
     PA1R_gp1984
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cupin_2 Cupin_7
Motif
Other DBs
NCBI-ProteinID: AHA23736
LinkDB All DBs
Position
2223673..2224206
Genome map
AA seq 177 aa AA seqDB search
MPELATREFWKDLQPIPDCFKPDAKPEVYLRNAPTEDERLYVPFTETVKSRPLWISPSEN
RWCDILMATSAGLVNRHYHPHEVFAYTISGKWGYLEHDWTATAGDFVYETPGEGHTLVAY
EHEQPMRAFFIVKGPLVWLDEKGNADGIFDVHDYIAMCREHYDKIGVGAAYIDSLFR
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atgcccgaactcgccacccgtgaattctggaaagacctgcaaccgattcccgactgcttc
aagccggacgccaagcccgaggtctacctgcgcaacgcgccgaccgaggacgagcgcctc
tacgtgcccttcaccgagaccgtgaagtcgcgtccgctgtggatctcgccaagcgaaaac
cgctggtgcgacatcctgatggcgacgagcgccggcctggtcaaccgccactaccacccg
cacgaggtgttcgcctacaccatcagcggcaagtggggctacctggagcacgactggacc
gccaccgccggcgacttcgtctacgagacgcccggcgagggccacaccctggtggcctac
gagcacgagcagccgatgcgtgcattcttcatcgtcaagggaccgctggtctggctcgac
gagaagggcaacgcggacggcatcttcgacgtccacgactacatcgcgatgtgccgtgag
cactacgacaagatcggcgtcggcgccgcctacatcgactccctgttccgctga

DBGET integrated database retrieval system