KEGG   Pseudomonas aeruginosa PA1R: PA1R_gp1987Help
Entry
PA1R_gp1987       CDS       T02929                                 

Definition
(GenBank) Short-chain dehydrogenase/reductase SDR
Organism
paer  Pseudomonas aeruginosa PA1R
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short Epimerase KR RmlD_sub_bind Oxidored_nitro GDP_Man_Dehyd DFP
Motif
Other DBs
NCBI-ProteinID: AHA23739
LinkDB All DBs
Structure
PDB: 

Position
2226606..2227331
Genome map
AA seq 241 aa AA seqDB search
MVFQHDIYAGQQVLVTGGSSGIGAAIAMQFAELGAEVVALGLDADGVHAPRHPRIRREEL
DITDSQRLQRLFEALPRLDVLVNNAGISRDREEYDLATFERVLRLNLSAAMLASQLARPL
LAQRGGSILNIASMYSTFGSADRPAYSASKGAIVQLTRSLACEYAAERIRVNAIAPGWID
TPLGAGLKADVEATRRIMQRTPLARWGEAPEVASAAAFLCGPGASFVTGAVLAVDGGYLC
A
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atggttttccaacacgatatctacgccggccagcaggtgctggtcactggcggcagctcc
ggcatcggcgcggccatcgccatgcagttcgccgaactcggcgccgaagtcgtcgccctc
ggcctggacgccgacggcgtgcacgcaccgcgtcatccgcggattcgccgggaagaactg
gacatcaccgacagccagcgcctgcaacggctgttcgaagcgctgccgcgcctggatgtg
ctggtgaacaacgcaggcatcagccgcgaccgcgaggaatacgacctggctaccttcgaa
cgggtgctgcgcctcaacctgagcgccgccatgctcgccagccaactggcccggccgctg
ctggcgcagcgcggcggcagcatcctcaacatcgcctcgatgtacagcaccttcggttcc
gccgaccgcccggcctacagcgccagcaagggcgccatcgtccagctcacccgttccctg
gcctgcgagtatgccgccgagcgcatccgggtcaacgccatcgcccccggctggatcgac
acgccgctgggcgccgggctcaaggccgacgtcgaggccacccgccggatcatgcagcgc
acgccgctggcgcgctggggcgaggcgcccgaggtggccagcgccgcggccttcctctgc
ggtcccggcgccagcttcgtcaccggcgccgtgctggcggtggacggcggctatctctgc
gcctga

DBGET integrated database retrieval system