KEGG   Pseudomonas aeruginosa PA1R: PA1R_gp2002Help
Entry
PA1R_gp2002       CDS       T02929                                 

Definition
(GenBank) Ribosomal protein S3AE
Organism
paer  Pseudomonas aeruginosa PA1R
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sigma70_r1_2
Motif
Other DBs
NCBI-ProteinID: AHA23754
LinkDB All DBs
Position
2241310..2241708
Genome map
AA seq 132 aa AA seqDB search
MSASPPLRQPCPPGACVCERERLEAPGADRRILLLTRQEEQRLAARLEALRSLEDLEHLL
RRMEEQLGIRLRIAPAFGEVRSMRGIRMRFEEQPGLCRKTRQAIPAAIRRGLEKRPEVAY
ALLNAHDLLRDA
NT seq 399 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcttccccgcccctccgccagccctgcccgcccggcgcctgcgtctgcgaacgc
gagcgcctggaggcgcccggcgcggatcgtcgcatcctcctcctgacccgccaggaagag
cagcgcctggccgcccgcctggaagccctgcgcagcctggaagacctggaacacctgctg
cggcgcatggaggaacaactgggcatccgcctgcggatcgccccggccttcggcgaggtg
cgcagcatgcgcggcatccgcatgcgcttcgaggagcagccggggctctgccgcaagacc
cgccaggcgattcccgccgccatccgccgcggcctggagaagcgcccggaagtcgcctac
gccctgctcaacgcccacgacctgctgcgcgacgcctga

DBGET integrated database retrieval system