KEGG   Pseudomonas aeruginosa PA1R: PA1R_gp2044
Entry
PA1R_gp2044       CDS       T02929                                 

Definition
(GenBank) 2,3-butanediol dehydrogenase, R-alcohol forming, (R)- and (S)-acetoin-specific
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
paer  Pseudomonas aeruginosa PA1R
Pathway
paer00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:paer00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    PA1R_gp2044
Enzymes [BR:paer01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     PA1R_gp2044
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     PA1R_gp2044
    1.1.1.-  
     PA1R_gp2044
SSDB
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_N_assoc ADH_zinc_N_2 AlaDh_PNT_C DAO 2-Hacid_dh_C Pyr_redox_2 UDPG_MGDP_dh_N NAD_binding_7
Other DBs
NCBI-ProteinID: AHA23796
LinkDB
Position
2292730..2293821
AA seq 363 aa
MNSSPQANAAMRAAVWHGRHDIRVEDVPLPAEPPPGWVQIRVHWCGICGSDLHEYLAGPV
FIPVEAPHPLTGLKDQCILGHEFSGEIVRLGNGVTGFAVGQAVAADACQHCGTCYYCRHG
LYNICENLAFTGLMNNGAFAEYVNVPANLLYALPAGFPSEAGALIEPLAVGMHAVKKAGS
LLGQNVVVVGAGTIGLSTIMCARAAGAAQVIALEMSSARKAKALEVGASQVLDPSRCDAL
GEIRALTGGLGADVSFECIGNKHTAKLAIDAIRKAGKCVLVGIFEEPSEFNFFELVSTEK
QLLGALAYNGEFADVIAFIADGRLDIAPLVTGRIGLEEIVERGFEELVNNKEHNVKIIVS
PGG
NT seq 1092 nt   +upstreamnt  +downstreamnt
atgaacagttccccgcaagccaacgcggcgatgcgcgccgccgtctggcacggccgccac
gatatccgcgtggaagacgtgccgctcccggccgagccgccgcccggctgggtgcagatc
cgcgtgcactggtgcggcatctgcggctccgacctgcacgaatacctggccggcccggta
ttcatccccgtggaggcgccgcacccgctcaccggcctcaaggatcaatgcatcctcggc
cacgagttcagcggcgaaatcgtccgcctcggcaacggcgtgaccggcttcgccgtcggc
caggcggtcgccgcagacgcctgccagcattgcggcacctgctactactgccggcatggg
ctgtacaacatctgcgagaacctggccttcaccgggctgatgaacaacggcgccttcgcc
gaatacgtcaacgtaccggccaacctgctctacgctctgccggccggatttcccagcgag
gccggcgcgctgatcgagccgctggcggtgggcatgcacgcggtgaagaaggccggcagc
ctgctcgggcagaacgtggtggtggtcggcgccggcaccatcggcctgagcaccatcatg
tgtgcgcgcgccgccggcgcggcacaggtgatcgccctggagatgtcctcggcgcgcaag
gccaaggccctggaggtcggcgccagccaggtgctcgacccctcgcggtgcgacgcccta
ggcgaaatccgcgccctcaccggcgggcttggcgccgacgtcagcttcgaatgcatcggc
aacaagcacaccgccaagctggccatcgatgccatccgcaaggccggcaagtgcgtgctt
gtgggaatcttcgaggagcccagtgaattcaatttcttcgagctggtttccaccgagaag
cagttgctcggggccctcgcctacaacggcgagttcgccgacgtgatcgccttcatagcc
gacggccgcctcgacatcgcaccgctggtgaccggtcgcatcggcctggaagaaatcgtc
gagcgcggtttcgaagagttggtgaacaacaaggagcacaacgtgaagatcatcgtctcg
ccgggcggctga

DBGET integrated database retrieval system