KEGG   Pseudomonas aeruginosa PA1R: PA1R_gp4426
Entry
PA1R_gp4426       CDS       T02929                                 

Definition
(GenBank) Alanyl-tRNA synthetase
  KO
K01872  alanyl-tRNA synthetase [EC:6.1.1.7]
Organism
paer  Pseudomonas aeruginosa PA1R
Pathway
paer00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:paer00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    PA1R_gp4426
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:paer01007]
    PA1R_gp4426
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:paer03016]
    PA1R_gp4426
Enzymes [BR:paer01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.7  alanine---tRNA ligase
     PA1R_gp4426
Amino acid related enzymes [BR:paer01007]
 Aminoacyl-tRNA synthetase
  Class II (C/G)
   PA1R_gp4426
Transfer RNA biogenesis [BR:paer03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    PA1R_gp4426
 Prokaryotic type
    PA1R_gp4426
SSDB
Motif
Pfam: tRNA-synt_2c DHHA1 tRNA_SAD CorA
Other DBs
NCBI-ProteinID: AHA26137
LinkDB
Position
4948386..4951010
AA seq 874 aa
MKSAEIREAFLRFFEEKGHTRVASSSLIPANDPTLLFTNAGMNQFKDCFLGLEKRAYTRA
TTSQKCVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKRDAIHYAWEFLTGEKWLN
LPKEKLWVTVYATDDEAYDIWTKEVGVPAERMVRIGDNKGAPYASDNFWAMGDTGPCGPC
TEIFFDHGPEIWGGPPGSPEEDGDRYIEIWNNVFMQFNRTADGVMHPLPAPSVDTGMGLE
RVSAVLQHVHSNYEIDLFQNLLKASAEAIGCANDDAPSLKVVADHIRSCSFLIADGVLPS
NEGRGYVLRRIIRRACRHGNKLGARGTFFHKIVAALVAEMGDAFPELKQQQAHIERVLKT
EEEQFAKTLEQGLKILEQDLAELQGSVIPGNVVFKLYDTYGFPVDLTNDIARERELTIDE
DGFEREMEAQRERARASSAFGMDYNSLVKVDGETRFLGYQGVSGAGQIVALFRDGQAVER
LEEGEEGVVVLDQTPFYAESGGQVGDSGYLEAAGVRFDVRDTTKAGGAHLHHGVVARGNL
SVGGAVKAEVDASVRQATALNHSATHLLHAALRQVLGDHVQQKGSLVDSQRLRFDFSHFE
AIKAEQLKALEDIVNAEIRRNTEVETEETDIDTAKAKGAMALFGEKYGDQVRVLSMGGDF
SVELCGGTHVSRTGDIGLFKITSEGGVAAGVRRIEAVTGAAALAYLNGAEEQLKEAASLV
KGSRDNLLDKLGALLERNRSLEKELEQLKAKAASAAGDDLSAAAVEIKGAKVLAARLDGL
DGKALLALVDQLKNKLGRAVILLGGELDGKVVLVAGVTQDLTGQLKAGELMKQAAAAVGG
KGGGRPDMAQGGGTDAAKLDEALALAQRFVEQGL
NT seq 2625 nt   +upstreamnt  +downstreamnt
atgaaaagcgctgaaatccgtgaagccttcctccgcttcttcgaagagaagggacacacc
cgtgtcgcttccagttcgctgatcccggcgaacgatccgaccctgctgttcaccaacgcg
ggcatgaaccagttcaaggactgcttcctcggcctggaaaagcgcgcctacacccgtgcg
accaccagccagaaatgcgtgcgcgccggcggcaagcacaacgacctggaaaacgtcggc
tacaccgcgcggcaccacaccttcttcgaaatgctgggtaacttcagcttcggcgactat
ttcaagcgcgacgccatccattacgcctgggagttcctcaccggcgagaaatggctgaac
ctgcccaaggaaaagctctgggtcaccgtctacgccaccgacgacgaagcctacgacatc
tggaccaaggaagtcggcgtgcccgccgagcgtatggtgcggatcggcgacaacaagggc
gcgccctatgcgtccgacaacttctgggcgatgggcgataccggaccctgcggtccctgc
accgagatcttcttcgaccatgggccggagatctggggcggcccgcccggttcgccggaa
gaggacggcgaccgctacatcgagatctggaacaacgtgttcatgcagttcaaccgcacc
gcggacggcgtcatgcacccgctgccggcgccgagcgtggacaccggcatgggcctggag
cgcgtcagcgcggtactccagcacgtgcactcgaactatgagatcgacctgttccagaac
ctgctgaaagcctccgccgaggccatcggctgcgccaacgacgacgcgccgtcgctgaag
gtggtagccgaccacatccgttcctgcagcttcctgatcgccgacggcgtactgccgtcc
aacgagggtcgcggctacgtcttgcggcggatcatccgccgcgcctgccgccacggcaac
aagctgggcgccaggggcaccttcttccacaagatcgtcgcagcgctggtcgccgagatg
ggcgatgccttccccgagctgaagcaacagcaggcacacatcgagcgcgtgctgaagacc
gaggaagaacagttcgccaagaccctggagcaaggcctgaagatcctcgaacaggacctc
gccgaactgcagggcagcgtgattcccggcaacgtggtgttcaagctgtacgacacctat
ggcttcccggtcgacctgaccaatgacatcgcccgcgagcgcgagctgaccatcgacgag
gacggcttcgagcgcgagatggaggcccagcgcgagcgcgcccgcgcttccagcgccttc
ggcatggactacaacagcctggtcaaggtcgacggcgagacccgcttcctcggctatcag
ggcgtctccggcgccgggcagatcgtcgcgctgttcagggacggccaggccgtcgagcgc
ctggaggagggcgaggagggcgtcgtggtcctcgaccagacgccgttctacgccgagtcc
ggcggccaggtcggcgacagtggctacctcgaggcggctggcgtgcgcttcgacgtgcgc
gataccaccaaggctggcggcgcgcacctgcaccatggcgtggtcgcccggggcaacctg
agcgtcggcggcgcggtcaaggccgaggtcgacgcctcggtacgccaggccaccgcgctc
aaccactccgcgacccacctgctgcatgccgcgctgcgccaggtactgggcgaccacgta
caacagaagggctcgctggtggacagccagcgcctgcgtttcgacttcagccacttcgag
gcgatcaaggcggaacaactgaaggccctggaggatatcgtcaacgccgaaatccgtcgc
aacaccgaggtcgagaccgaggaaaccgatatcgacaccgccaaggccaagggcgccatg
gcgctgttcggcgagaagtacggcgaccaggtgcgcgtactgagcatgggcggcgatttc
tccgtcgagctgtgcggtggcacccacgtatcccgcaccggcgacatcggcctgttcaag
atcaccagcgagggtggcgtggctgccggcgtacgccgtatcgaggcggtcaccggcgcg
gcggcgctggcctacctgaacggtgccgaggagcagctcaaggaagccgccagcctggtc
aagggcagccgcgacaacctgctggacaagctcggcgccctgctggagcgcaaccgctcg
ctggagaaggagctggaacagctcaaggccaaggctgccagcgcggccggcgacgacctt
tcggcggcggcggtggaaatcaagggcgcgaaggtactcgccgcgcgcctcgatggtctg
gacggcaaggcgctgctggcgctggtcgaccagttgaagaacaagctcggccgcgcagtg
atcctgctcggcggcgagctggacgggaaggtcgtactggtcgcaggcgtgacccaggac
ctgaccggccaactgaaggccggcgagcttatgaagcaagccgcggcggcagttggtggc
aaaggtggcggacgcccggatatggcccagggcggcggcaccgatgcagcgaaattggac
gaggccctggccctggcccagcgcttcgtcgagcaagggctctga

DBGET integrated database retrieval system