KEGG   Pseudomonas aeruginosa PA1R: PA1R_gp4565
Entry
PA1R_gp4565       CDS       T02929                                 

Definition
(GenBank) Conjugative transfer protein PilL in PFGI-1-like cluster
Organism
paer  Pseudomonas aeruginosa PA1R
SSDB
Motif
Pfam: TcpQ
Other DBs
NCBI-ProteinID: AHA26271
LinkDB
Position
complement(5097139..5098101)
AA seq 320 aa
MRYGRYTLVSTQPDAGQRDLMAQIIDVPIPSSMNPSVKDAMQYVMSRSGYSLCPAEAGHV
NILYTRPLPAAQYKLGPMTLRNTLQVLSGPAWQVKVDEVARQVCFVLRPGYQLPPAPRPK
PVQQLYAKPAAPTPAAVAQPSSTEKVSTLESPVVVASVPTPAPITTSPAPTKKPESTTVL
PPAAPAKDGHPSSPPAASAPIKPLASAVKSTPPNPATVVSAPPVKVLTPTEPSRQLTQSW
SAETGSTLRDTLEAWAKRARWTVRWEPQDLNYPIEAPLTFHGSFEDAVSELFPLYDAAER
PFLVNASRPQSLIIIKERKN
NT seq 963 nt   +upstreamnt  +downstreamnt
gtgcgctacgggcgctacaccctggtcagcacccagccggacgctggccagcgcgacctg
atggcacagattatcgacgtgcccatcccgtcgagcatgaacccgagcgtcaaagatgcc
atgcagtacgtgatgagccgctcgggttactcgctgtgcccggcagaggccggtcatgtg
aacatcctctacacccggccgctgccggcggctcagtacaagctcggccccatgaccctg
cgcaacaccctccaggtcctctccggccctgcctggcaggtgaaggttgacgaggtcgcg
cggcaggtctgcttcgtgctgcgcccgggctatcaacttcccccggcgccgaggccgaaa
ccggtccagcaactgtatgcgaagcccgctgccccaactccagcggcggtagcgcaaccc
tcctccacggaaaaagtcagcacgctggagtcgcccgtcgtggtcgcctcggtgccaacg
ccggcgccgatcacaaccagccccgctccgaccaagaagcctgaatccaccactgtgctc
cccccagccgcaccggccaaggatggccacccctcttctcctcccgcggcgtcagcaccg
atcaagcccctggcttccgccgtgaagtccacgccgcccaatccggccaccgtggtttcc
gcccctccggtcaaggtgctcacgccgacagagccgagccggcagttgacacagtcctgg
tcagccgaaacgggatcaaccctgcgcgacaccttggaagcctgggccaagcgcgcacgc
tggaccgtccgctgggagccgcaggatctcaactatccgatcgaagctcctctgaccttc
cacggctccttcgaggacgcggtatccgagctgttcccgctgtatgacgctgccgaacgg
cccttcctggtgaacgccagccgcccgcagtccctgatcatcatcaaggagcgcaagaac
tga

DBGET integrated database retrieval system