KEGG   Pseudomonas aeruginosa PA1R: PA1R_gp5617Help
Entry
PA1R_gp5617       CDS       T02929                                 

Definition
(GenBank) ATP-dependent DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
paer  Pseudomonas aeruginosa PA1R
Pathway
paer03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:paer00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    PA1R_gp5617
Enzymes [BR:paer01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     PA1R_gp5617
DNA repair and recombination proteins [BR:paer03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     PA1R_gp5617
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_C DNA_ligase_A_M DNA_primase_S
Motif
Other DBs
NCBI-ProteinID: AHA27317
LinkDB All DBs
Structure
PDB: 

Position
6225427..6227949
Genome map
AA seq 840 aa AA seqDB search
MPSSKPLAEYARKRDFRQTPEPSGRKPRKDSTGLLRYCVQKHDASRLHYDFRLELDGTLK
SWAVPKGPCLDPAVKRLAVQVEDHPLDYADFEGSIPQGHYGAGDVIVWDRGAWTPLDDPR
EGLEKGHLSFALDGEKLSGRWHLIRTNLRGKQPQWFLVKAKDGEARSLDRFDVLKERPDS
VLSERTLLPRHGEAATPAARPARRGKSGGKTPMPEWIAPELASLVEQPPRGEWAYELKLD
GYRLMSRIEDGHVRLLTRNGHDWTERLPHLEKALAGLGLQRSWLDGELVVLDEEGRPDFQ
ALQNAFEEGRGENILYVLFDLPYHEGEDLRDVALEERRARLEALLEGRDEDPLRFSATLA
EDPRDLLASACKLGLEGVIGKRLGSAYRSRRSNDWIKLKCQLRQEFVIVGYTEPKGSRRH
IGALLLGLYSPDEERRLRYAGKVGSGFTAASLKKVRERLEPLAVRSSPLAKVPPARETGS
VQWVRPQQLCEVSYAQMTRGGIIRQAVFHGLREDKPAREVTGERPAGPPPLRGARKAGAG
ASRAATAGVRISHPQRLIDPSIQASKLELAEFHARYADLLLRDLRERPVSLVRGPDGIGG
ELFFQKHAARLKIPGIVQLDPALDPGHPPLLQIRSAEALVGAVQMGSIEFHTWNASLANL
ERPDRFVLDLDPDPALPWKRMLEATQLSLTLLDELGLRAFLKTSGGKGMHLLVPLERRHG
WDEVKDFAQAISQHLARLMPERFSAVSGPRNRVGKIFVDYLRNSRGASTVAAYSVRAREG
LPVSVPVFREELDSLQGANQWNLRSLPQRLDELAGDDPWADYAGTRQRISAAMRRQLGRG
NT seq 2523 nt NT seq  +upstreamnt  +downstreamnt
atgcccagcagcaagccgctcgccgagtacgcccgcaagcgcgatttccgccagaccccg
gagcccagcggccgcaagcctcgcaaggacagcaccgggctgctccgctattgcgtccag
aagcacgacgccagccgcctgcactacgacttccgcctggagctggatggcaccctgaag
agctgggcggtgcccaaggggccgtgcctcgacccggcggtgaagcggctcgcggtgcag
gttgaggaccatccgctggactatgccgatttcgaaggcagcatcccccaggggcactac
ggcgccggcgatgtcatcgtctgggaccgaggcgcctggacgcctctggacgatccgcgc
gagggcctggaaaagggccatctcagcttcgccctggatggcgagaaactctccgggcgt
tggcacctgatccgcaccaacctgcgcggcaagcagccccagtggttcctggtcaaggcc
aaggacggcgaggcgcgcagcctggatcgcttcgacgtgctgaaggagcgtcccgacagc
gtgctcagcgagcgtacgctgctgccccgccatggcgaagccgccacgcccgcggccagg
ccggcgcgacgcggcaagagcggggggaagacgccgatgcccgagtggatcgcccccgag
ctggccagcctggtcgagcagcctccgcgaggggagtgggcctacgaactcaagctggac
ggctatcggctgatgagccgcatcgaagacggccacgtgcgcctgctgacccgcaacggc
catgactggaccgaacgcctgccgcacctggagaaggccttggccgggctcggtctgcag
cgcagttggctggacggcgaactggtcgtcctcgacgaggagggtcgaccggacttccag
gccctgcagaacgccttcgaggaaggtcgcggcgagaacatcctgtacgtcctcttcgac
ctgccgtaccacgaaggcgaggatctgcgcgatgtcgccctggaggagcgccgcgcgcgc
ctggaggcgctgctggaagggcgagacgaagacccgctgcggttctccgcgacgctcgcg
gaagacccccgcgacctgctggccagcgcctgcaagctcggtctcgaaggcgtgatcggc
aagcgtctgggcagcgcctaccgttcgcgccgcagcaacgactggatcaagctgaagtgc
cagttgcgccaggagttcgtgatcgtcggctataccgagccgaagggctctcgccggcat
atcggcgccttgctgctcggcctctacagccctgacgaggagcgccggctgcgctatgcc
ggcaaggtcggcagcggcttcaccgcggccagcctgaagaaggtccgtgagcgcctggaa
cccctcgcggtccgttccagcccattggcgaaggtgccgccggcgcgcgagaccgggtcg
gtgcagtgggtgcgcccgcaacagctgtgcgaggtttcctatgcgcagatgacccgtggc
gggatcatccgccaggcagtgttccacggcttgcgcgaagacaagccggcgcgtgaggtg
accggcgagcgtcccgccggcccgccgccgctgcgcggcgcgcgcaaggccggcgccggt
gcgtcgcgggcggccaccgccggcgtgcgcatcagccatccgcagcggctgatcgacccg
tcgatccaggccagcaagctggaactcgccgagttccatgcgcgctacgccgacctgctc
ctgcgcgacctgcgcgagcgcccggtgtcgctggtgcgcggccccgacggaatcggcggc
gaactgttcttccagaagcacgcggcgcgcctgaagatccccggcatcgtccagctcgac
ccggcgctcgatcccggtcatccgccgctgttgcagatccgcagcgccgaggcgctggtc
ggcgcggtgcagatgggcagcatcgaattccatacctggaacgccagcctggccaacctg
gagcggcccgaccgtttcgtcctcgacctcgacccggacccggcgctgccgtggaagcgc
atgctcgaagcgacccagctgagcctgacgttgctcgacgagctgggcctgcgcgccttc
ctcaagaccagcggcggcaagggcatgcacctgctggtgccgctggagcgccggcatggc
tgggacgaggtcaaggatttcgcccaggccatctcccagcacttggcgcgcctgatgccg
gagcgtttctcggcggtttccgggccgcgcaaccgggtcggcaagatcttcgtcgactac
ctgcgcaacagccgcggcgccagcaccgtggccgcctactcggtgcgcgcccgcgaaggg
ttgccggtgtcggtaccggtgttccgcgaggaactcgactcgctgcagggcgccaaccaa
tggaacctgcgcagtctgccgcagcgcctcgacgaactcgccggcgacgatccctgggcc
gactacgccggcacccgccagcgcatcagcgcggccatgcggcgccagctcgggcgcggc
tga

DBGET integrated database retrieval system