KEGG   Pseudomonas aeruginosa SCV20265: SCV20265_0075Help
Entry
SCV20265_0075     CDS       T02971                                 

Definition
(GenBank) Serine/threonine protein kinase PpkA
  KO
K11912  serine/threonine-protein kinase PpkA [EC:2.7.11.1]
Organism
paes  Pseudomonas aeruginosa SCV20265
Pathway
paes02025  Biofilm formation - Pseudomonas aeruginosa
paes03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:paes00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    SCV20265_0075
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02025 Biofilm formation - Pseudomonas aeruginosa
    SCV20265_0075
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:paes01001]
    SCV20265_0075
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:paes02044]
    SCV20265_0075
Enzymes [BR:paes01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     SCV20265_0075
Protein kinases [BR:paes01001]
 Serine/threonine kinases: Other
  Bacterial family
   SCV20265_0075
Secretion system [BR:paes02044]
 Type VI secretion system
  Imp/Vas secretion system related proteins
   SCV20265_0075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr TssR VWA APH VWA_2 Pkinase_fungal Kinase-like Kdo
Motif
Other DBs
NCBI-ProteinID: AHC74189
LinkDB All DBs
Position
complement(87168..90266)
Genome map
AA seq 1032 aa AA seqDB search
MDIELPGFDIERELGEGAMATVYLATQRSLQRKVALKVMAAALAADPSFAERFLREGRTL
ARLSHPNTVTIHDIGNVGSCYYMAMEYLPNGTLKERIQQGLDPELGLVYVRQVAAALGYA
HSQGLVHRDVKPANILFRADGTAVLSDFGIAKSIEDNTQFTQVGFAVGTPSYMSPEQARG
QEIDGRADLYALGVVLYEILTGKLPYNGKDSLSTALAHLTEPLPELPIEQGRYQDILRQL
LAKDPAERFPTAGALIAALDRLAPSALEATQIRPLATPQGSPRASNPPPAEPAPMPPADL
GGLQPVSIQLPPVTPSAGGATPPPPPPSQAAKPPSPPPPPLPPAKPRAGGSRTPLIAAAA
AAVLLAIGGGAWWLLSSGDAPSAADPAPLGQTPADKPQQQTPVADAEQDGGERPLLMPGK
KTLFQRVLTKPGAAISAEAGGPPRAGAVPAFSVLYVYARKQVGGSPWLRVGASSNGEGDG
WLPASAVSDWKQSLVLKFTERSGRAPVMFLNSAEQVERLLGDTRAARDTLTQAVDHKGDP
QVVAVEPNDRAIPQDQFYLLPIFDSKESFDADGQPAQLLEVASIDPGGSAAAPQAPGQAG
QGGASGAASDTFRTGIVLVVDTSVSMQPYIDRVREVIDGLQRQIGERGDLDKVSFGLVGF
RNNTDKTPGLEYVSKTLVPLQPGNDAQRFAELSSQVRATDVSSHSFNEDAFAGIMQAVDE
MDWSPYAGRVVLLVTDAGALRKNDPLGRTQMNEAEVRQAALRKGVKIYALHLRTPAGKNN
HGYAEQQYRSLTADANPKIADLYIPVAGGEVNAFGNTVKEIGTVFADLVHDAGNRKPQAP
RFDAAPSVASKSAAIGYAMQMEFLGRRDPVRAPQVVTAWTADRDLTNPALPAFQVCVLLS
KLQLNELQQSLKLIVDAAKRTQTSPKDFFQEIASASAYMSRDPAQLVKGSNLAQSGVLGE
YLEGLPYRSKSLNMTQDLWLSLSVAEQQDFIDELESKIRLYETFHNDVANWVRFGDADAG
DALYRVPLSTLP
NT seq 3099 nt NT seq  +upstreamnt  +downstreamnt
atggacatagaacttccgggattcgacatcgaacgcgagctgggcgaaggcgccatggcc
acggtctacctggccacccagcgctcgctgcagcgcaaggtggcgctgaaggtgatggcc
gcggcgctagccgccgacccgagcttcgccgaacgcttcctgcgcgaaggtcggaccctg
gcgcggctgtcgcacccgaacacggtgaccatccacgacatcggcaacgtcggcagttgc
tactacatggccatggaatacctgcccaacggcacgctcaaggagcgcatccagcagggc
ctcgatcccgagctgggcctggtctacgtacggcaggtggccgccgcgctcggctacgcg
cactcccagggcctggtgcatcgcgacgtgaagccggccaatatcctgttccgcgccgac
ggcaccgcggtgctctcggacttcggcatcgccaagtcgatcgaggacaatacccagttc
acccaggtcggcttcgccgtcggcacccccagctacatgagcccggagcaggcccgcggg
caggagatcgacggccgcgccgacctctacgcgctgggcgtggtgctctacgagatcctc
accggcaagctgccctacaacggcaaggattcgctctccaccgccctggcccacctcacc
gagccgctaccggaactgccgatcgagcagggccgctaccaggacatcctgcgccagttg
ctggccaaggacccggccgagcgcttccccaccgccggcgcgctgatcgccgccctcgac
cgcctggcgccgagcgccctggaagccacccagatccgtccgctggcgacgccgcagggc
tcgccgcgagcgagcaacccgccgccggccgaacccgcgcccatgccgcccgccgacctc
ggcggcctgcaaccggtatcgatccagttgccgccggtcacgcccagcgccggcggcgcc
acgccgcccccgcctccgccatcgcaagcggcgaaaccgccatcgcccccgccgcctccg
ctgccaccggcgaagccgcgtgccggcggcagccgcacgccgctgatcgccgccgccgcg
gccgccgtgctcctggcgatcggcggcggcgcctggtggctgctgagctcgggcgacgcg
ccgagcgctgccgatccagcgccgctgggacagacgccggcggacaagccgcagcagcag
accccggtggccgatgccgaacaggacggcggcgagcgtccgctgctgatgccaggcaag
aagaccctgttccagcgcgtcctgaccaaacccggcgcggccatctccgccgaggctggc
ggcccgccccgggccggcgcggtgccggccttctcggtgctctacgtgtacgcccgcaag
caggtcggcggcagcccctggctgcgcgtcggcgcctccagcaacggcgagggcgacggc
tggctgccggccagcgcggtgagcgactggaagcagagcctggtgctgaagttcaccgaa
cgctccggccgcgcgccggtgatgttcctcaacagcgccgagcaggtcgagcgcctgctc
ggcgatacccgcgcagcgcgcgataccctgacccaggcggtggatcacaagggcgatccg
caggtggtcgcggtcgagcccaacgaccgggcgatcccccaggaccagttctacctgctg
ccgatcttcgactcgaaggaaagcttcgacgccgacggccagccggcgcagttgctggag
gtcgcctcgatcgaccccggcggcagcgccgcggcaccccaggcgccgggccaggccggg
cagggcggcgccagcggcgcggcgagcgacaccttccgcaccggcatcgtcctggtggtg
gacacctcggtgtcgatgcagccctacatcgaccgcgtgcgcgaggtgatcgacggcctg
cagcggcagatcggcgagcgcggcgacctggacaaggtcagcttcggcctggtcggtttc
cgcaacaacaccgacaagacccccggcctggaatacgtcagcaagaccctggtgccgctg
caaccgggcaacgacgcgcagcgcttcgccgagttgagcagccaggtgcgcgccaccgac
gtctccagccactcgttcaacgaagacgccttcgccgggatcatgcaggcggtcgacgaa
atggactggtcgccctacgccgggcgcgtggtgctgctggtcaccgacgccggcgcgctg
cgcaagaacgacccgctcgggcgcacccagatgaacgaggccgaggtccgccaggcggcg
ctgcgcaagggcgtgaagatctatgccctgcacctgcgcaccccggccgggaagaacaac
cacggctacgccgagcagcagtaccgcagcctcaccgccgacgccaacccgaagatcgcc
gacctctacatcccggtggccggcggcgaggtgaacgccttcggcaacacggtgaaggag
atcggcacggtgttcgccgacctggtccacgacgccggcaaccgcaagccgcaggcgccg
cgcttcgacgccgcgccaagcgtggcgagcaagtcggcggccatcggctacgccatgcag
atggaattcctcggtcgccgcgacccggtgcgcgcgccgcaggtcgtcaccgcctggacc
gccgaccgtgacctgaccaacccggcgctgccggcgttccaggtctgcgtgctgctgagc
aagctgcaactcaacgaactgcaacagtcgctgaaactgatcgtcgacgcggccaagcgt
acccagacctcgcccaaggacttcttccaggaaatcgccagcgccagcgcctacatgagc
cgcgacccggcgcaactggtgaagggcagcaacctggcacagagcggcgtgctcggcgaa
tacctggaaggcctgccgtaccgcagcaagtcgctgaacatgacccaggacctctggctg
tcgctgagcgtcgccgaacagcaggacttcatcgacgaactggagtcgaagatccgcctc
tacgaaaccttccacaacgacgtcgccaactgggtccggttcggcgacgccgacgccggc
gacgcgctgtaccgcgtgccgctgtcgacgctgccatga

DBGET integrated database retrieval system