KEGG   Pseudomonas aeruginosa SCV20265: SCV20265_0640Help
Entry
SCV20265_0640     CDS       T02971                                 

Definition
(GenBank) Anthranilate synthase, aminase component
  KO
K01657  anthranilate synthase component I [EC:4.1.3.27]
Organism
paes  Pseudomonas aeruginosa SCV20265
Pathway
paes00400  Phenylalanine, tyrosine and tryptophan biosynthesis
paes00405  Phenazine biosynthesis
paes01100  Metabolic pathways
paes01110  Biosynthesis of secondary metabolites
paes01130  Biosynthesis of antibiotics
paes01230  Biosynthesis of amino acids
paes02024  Quorum sensing
paes02025  Biofilm formation - Pseudomonas aeruginosa
Module
paes_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:paes00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SCV20265_0640
  09110 Biosynthesis of other secondary metabolites
   00405 Phenazine biosynthesis
    SCV20265_0640
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    SCV20265_0640
   02025 Biofilm formation - Pseudomonas aeruginosa
    SCV20265_0640
Enzymes [BR:paes01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.27  anthranilate synthase
     SCV20265_0640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Chorismate_bind Anth_synt_I_N
Motif
Other DBs
NCBI-ProteinID: AHC74754
LinkDB All DBs
Position
668221..669699
Genome map
AA seq 492 aa AA seqDB search
MNREEFLRLAADGYNRIPLSFETLADFDTPLSIYLKLADAPNSYLLESVQGGEKWGRYSI
IGLPCRTVLRVYDHQVRISIDGMETERFDCADPLAFVEEFKARYQVPTVPGLPRFDGGLV
GYFGYDCVRYVEKRLATCPNPDPLGNPDILLMVSDAVVVFDNLAGKIHAIVLADPSEENA
YERGQARLEELLERLRQPITPRRGLDLEAAQGREPAFRASFTREDYENAVGRIKDYILAG
DCMQVVPSQRMSIEFKAAPIDLYRALRCFNPTPYMYFFNFGDFHVVGSSPEVLVRVEDGL
VTVRPIAGTRPRGINEEADLALEQDLLSDAKEIAEHLMLIDLGRNDVGRVSDIGAVKVTE
KMVIERYSNVMHIVSNVTGQLREGLSAMDALRAILPAGTLSGAPKIRAMEIIDELEPVKR
GVYGGAVGYLAWNGNMDTAIAIRTAVIKNGELHVQAGGGIVADSVPALEWEETINKRRAM
FRAVALAEQSVE
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgcgaagaattcctgcggctggccgccgatggctacaaccgcatcccgctgtcc
ttcgagacccttgccgacttcgacacgccgctgtcgatctacctgaagctggccgacgcg
ccgaactcctacctgctggagtcggtgcagggcggcgagaaatgggggcgctattcgatc
atcggcctgccgtgccgcacggtgctgcgggtctacgaccatcaagtacggatcagcatc
gatggcatggaaaccgagcgcttcgattgcgccgacccgctggctttcgtcgaggagttc
aaggcgcgctaccaggtgcccaccgtgcccggcttgccacgtttcgatggaggcctggtc
ggctacttcggttacgactgcgtgcgctacgtggaaaaacgcctggccacctgtccgaac
ccggacccgctgggcaacccggatatcctgttgatggtgtccgatgccgtagtggtattc
gacaatctggccgggaagatccacgccatcgtcctcgccgatccctccgaggaaaatgcc
tacgagcgcggccaggcacgtctggaggagctgctggagcgtctgcgccagccgatcacc
ccgcgtcgcggcctcgacctcgaggcggcccagggtcgtgagccggcgtttcgtgccagc
ttcacccgcgaggactatgaaaacgcggtaggaaggatcaaggactacatcctggccggc
gactgcatgcaggtggtgccgtcgcagcgcatgtccatcgaattcaaggcggcgcccatc
gacctgtaccgcgcgctgcgctgtttcaatccgacgccctacatgtacttcttcaacttc
ggcgacttccatgtcgtgggcagctcgccggaggtgctggtacgggtcgaggatggcctg
gtgacggtgcgcccgatcgccggtacccgtccgcgcgggatcaacgaagaggccgacctg
gcgctggagcaggatctgctgtcggacgccaaggagatcgccgagcacctgatgctgatc
gacctggggcgcaacgacgtggggcgggtgtccgacatcggcgcggtgaaggtcaccgaa
aaaatggtgatcgaacgttactccaacgtcatgcacatcgtgtccaacgtcaccgggcaa
ttgcgcgaggggctcagcgcgatggacgcgctgcgggcgatcctgccggcgggtacgctg
tccggcgcgccgaagatccgcgccatggagatcatcgacgagctggagccggtcaagcgt
ggagtctacggcggcgcggtcggctacctggcatggaacggcaacatggacaccgccatt
gccatccgcaccgcggtgatcaagaacggtgaactccacgtgcaggccggcggcggtatc
gttgccgactcggtgccggcgctggagtgggaagaaaccatcaacaagcgccgggcgatg
ttccgcgccgtggcgctggccgagcagagcgtcgagtaa

DBGET integrated database retrieval system