KEGG   Pseudomonas aeruginosa SCV20265: SCV20265_0861Help
Entry
SCV20265_0861     CDS       T02971                                 

Definition
(GenBank) HDIG domain protein
Organism
paes  Pseudomonas aeruginosa SCV20265
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3391 HD HD_5 HDOD
Motif
Other DBs
NCBI-ProteinID: AHC74975
LinkDB All DBs
Position
complement(907078..908283)
Genome map
AA seq 401 aa AA seqDB search
MFVQSLCGSWLDHPFWKRGGFLLDSQADLQRLRESAVKEVWIDASKGLDLPEEAAVSAAA
VLPVTMPAGPSPARVALEEEIRHAALLCSRAKAAVVSMFRDARMGQAIDTAHASDLVDEI
SASVLRHPNALLSLVRLKTSDEYTYMHSVAVCALMIALARQLELPDPLVREAGLAGLLHD
IGKMAVPDPILNKPGKLTDPEFGLVRRHPQNGARMLLDCRQVSALVVDVCLHHHERIDGT
GYPFGLAQEQISLLARMGAVCDVYDAITSDRPYKKGWNAAEAIRRMAEWNGHFDPQVFRA
FVKAVGIYPVGALVRLESGRLGVVLEQHGRSLLTPRVKVFFSARSKVPIPQQVVDLGRAG
QTDRIVGFEPAEAWNFRNLDEMWTGLAKSTGSYFDAGTGNP
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgttcgtccagagcctttgcggctcgtggctggaccacccgttctggaaaagaggtggc
ttcctgctcgacagccaggccgacctgcagcgcctgcgcgaaagcgccgtgaaggaggtc
tggatcgatgccagcaagggcctcgacctcccggaggaagcggcggtctcggccgctgcg
gtcctgccggtcaccatgccggccggcccttcgccggcgcgggtcgccctggaggaggaa
atccgccacgccgccctgctctgcagccgtgccaaggccgccgtggtcagcatgttccgc
gacgcgcgcatgggccaggccatcgataccgcgcatgcatcggacctggtggacgaaatc
tccgcctcggtgctgcgccatcccaacgcgctgctcagcctggtacggctgaagacctcg
gatgaatacacctacatgcattcggtggcggtctgtgcgctgatgatcgccctcgcccgc
cagctcgaactgcccgacccgctggtacgcgaggcggggctggccggactgctgcacgac
atcggcaagatggcggtgcccgatccgatcctgaacaagcccggcaagctcaccgacccg
gagttcggcctggttcgccggcatccgcagaacggcgcgcggatgctgctcgattgccgc
caggtcagtgccctggtggtggatgtctgcctgcaccaccacgagcgcatcgacggcacc
ggctaccccttcggcctggcgcaggagcagatcagcctgctggcgcgaatgggcgcggtg
tgcgacgtctacgacgcgatcacctccgaccgtccctacaagaagggctggaacgccgcc
gaggcgatccgacgcatggccgaatggaacgggcacttcgacccgcaggtgttccgcgcc
ttcgtcaaggcggtgggcatctacccggtcggcgcgctggtcaggctggaaagcgggcgc
ctcggcgtggtcctcgaacaacacggccgctcgctgctgacgccacgggtcaaggtattc
ttctcggcccgctcgaaggtgccgatcccgcagcaggtggtagacctgggtagggccgga
cagaccgaccgaatcgtcggcttcgagccggcggaagcctggaacttccgcaatctcgac
gagatgtggacgggactggccaagtccacgggctcttatttcgacgcgggaaccggaaat
ccgtag

DBGET integrated database retrieval system