KEGG   Pseudomonas aeruginosa SCV20265: SCV20265_0876Help
Entry
SCV20265_0876     CDS       T02971                                 

Definition
(GenBank) Major facilitator family transporter
Organism
paes  Pseudomonas aeruginosa SCV20265
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 Sugar_tr MFS_1_like Nuc_H_symport LacY_symp
Motif
Other DBs
NCBI-ProteinID: AHC74990
LinkDB All DBs
Position
complement(919996..921255)
Genome map
AA seq 419 aa AA seqDB search
MAHNNNSASYENVLLCVLFLTFGFVFFDRLALSFLFPFMEQELQLSNSHLGMLSSVLALA
WAVSGALVGAWSDRRGQRKPLLIVAVILFSLCSALSGLVGGFLSLLLFRGIMGLAEGPIL
PLSQSLMVEASSPHRRGLNMGLLQGSAAGLLGAVIGPPLLVALAETLGWRHAFIVSLLPG
LLIAWLIWRHVRPDPPRAQRPAPRAEEAKGKRLALLKSRNILLCTLISCVFVTWFIVLIS
FTPTFLVNARGFSPATMGRLMSCLGVAWVVWGFAVPAISDRIGRRPTLVAFSLLAACCPL
ALLYAPNATSLGLLLLLTYTGLGCFTLFMATIPAETVSRGVIATALGLIMGLGELVGGFL
APTVAGFAADRFGLSIVMWMSCGGALLAAFLSLFLRETAPAVLARQRSAPTSVLQGNQP
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atggcgcataacaacaattccgccagttacgaaaacgtcctgctctgcgtgctgttcctg
accttcggcttcgtcttcttcgaccgcctggcgctgtccttcctgtttcccttcatggaa
caggagctgcaactgagcaacagccacctgggcatgctctcctcggtgctggccctggcc
tgggcggtatccggcgcgctggtcggcgcctggtccgaccgccgcgggcagcgcaagccg
ctgctgatcgtggcggtgatcctgttctcgctgtgctcggcgctgtccgggctggtcggc
ggcttcctcagcctgctgctgttccgcggcatcatgggcctggccgaggggccgatcctg
ccgctctcgcaatcgctgatggtcgaggcctcctcgccacatcgccgcggcctcaacatg
ggtctgctacagggctcggcggccggcctgctcggcgcggtgatcggcccgccgctgctg
gtggccctggccgaaaccctcggctggcgtcacgccttcatcgtctcgttgctgccgggc
ctgctgatcgcctggttgatctggcgccatgtgcgtcccgacccgccccgcgcgcagcgc
ccggcgccgcgcgcagaagaagcgaaaggcaagcgcctggcactgctgaagagccgcaac
atcctgctctgcaccctgatcagttgcgtattcgtcacctggttcatcgtgctgatttcc
tttaccccgaccttcctggtcaacgcccgcggcttcagcccggcgaccatgggcaggctg
atgagctgcctgggcgtcgcctgggtggtctggggcttcgccgtaccggcgatatccgat
cgcatcggccgtcgaccgaccctggtggcgttctccctgctcgccgcgtgttgcccgctg
gcgctgctctatgcgccgaacgcgaccagcctcggcctgctgttgctgctgacctacacc
gggctcggctgcttcaccctgttcatggcgaccatcccggcggagaccgtctcgcgcggc
gtcatcgccaccgccctcggcctgatcatgggcctcggcgaactggtcggcggtttcctc
gcgccgaccgtggccggcttcgccgccgaccgcttcggcctgtccatcgtcatgtggatg
tcctgcggcggcgccctgctcgccgcgttcctctcgctgttcctgcgcgaaaccgcgccc
gccgtgctggcgcgccagcgcagcgcgcctacctccgtcctgcaaggaaaccaaccatga

DBGET integrated database retrieval system