KEGG   Pseudomonas aeruginosa SCV20265: SCV20265_0973Help
Entry
SCV20265_0973     CDS       T02971                                 

Definition
(GenBank) Penicillin-binding protein 2 (PBP-2)
  KO
K05515  penicillin-binding protein 2 [EC:3.4.16.4]
Organism
paes  Pseudomonas aeruginosa SCV20265
Pathway
paes00550  Peptidoglycan biosynthesis
paes01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:paes00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SCV20265_0973
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    SCV20265_0973
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:paes01011]
    SCV20265_0973
Enzymes [BR:paes01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     SCV20265_0973
Peptidoglycan biosynthesis and degradation proteins [BR:paes01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   SCV20265_0973
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer
Motif
Other DBs
NCBI-ProteinID: AHC75087
LinkDB All DBs
Position
1013959..1015899
Genome map
AA seq 646 aa AA seqDB search
MPQPIHLKDHEKDARLVRRRVIVGAVAVVLLTLVLVARMYHLQVTQYEYHSTLSENNRVH
VQPIPPTRGIIFDRNGVIIADNRPSFSLTITRERTEDLQKTLDTLVEILGLTEDDRAIFE
KRMKQGRRPFEPVPIMFELNEEQIARIAVNQFRLPGVDVATQFVRHYPLKEHFAHSVGYV
GRINEQELKNLDPINYSGTHHIGKTGIERFYESELHGTVGYEEVETNARGRVLRVLKRTD
PIPGKDIVLSIDSRLQEAAENALAGRRGAIVAIQPSTGDVLAMVSQPSYDPNLFVTGISF
KAYAELRDSIDRPLYNRVLRGLYPPGSTVKPAVALAGLDAGVVTPTSRVFDPGYYQLPNY
DHKYRNWNRYGDGWVSLESAIYRSNDTYFYDLAHKLGIDRLHAFMSRFGFGQKVALDMFG
EADGLMPSREWKRKTRRQVWYPGETLILGIGQGYMQATPIQLAQMTALLANKGHWIRPHL
AKTIDGQPPVDPDPMPDIVLRDPANWDRVDYGMQQVVHGARGTARKVGATSAYLIAGKSG
TAQVVAIKQNERYDRSKLLERHRDHALFVGFAPANNPQIAVAVMVENGESGSGVAAPVVK
QVMDAWLLDEHGKLKAEYAEPVAPLAAAVAKPEPTAAEPEAPALEQ
NT seq 1941 nt NT seq  +upstreamnt  +downstreamnt
atgccgcagccgatccacctgaaagaccacgagaaagacgcccgcctggtgcgtcggcgc
gtcatcgtcggggcggtggcggtggtcttgctgaccctggtgctggtggcgcgcatgtac
cacctgcaggtgacccagtacgagtaccattcgacgctgtcggagaacaaccgggtccat
gtgcagccgatcccgccgacccgcgggatcatcttcgaccgcaacggcgtgatcatcgcc
gacaaccgaccgagcttcagcctgaccatcacccgcgaacgcaccgaggacctgcagaag
accctcgacacgctggtggagatcctcggcctgaccgaggacgaccgggccatcttcgag
aagcgcatgaagcaggggcggcgtccgttcgagccggttcccatcatgttcgaactcaac
gaggaacagatcgcccgcatcgcggtgaaccagttccgcctgccgggcgtcgacgtggcg
acccagttcgtccgccactacccgctgaaggagcacttcgcccattcggtcgggtacgtc
gggcggatcaacgagcaggaactgaagaacctcgacccgatcaactacagcggcacccac
catatcggcaagaccggcatcgagcgcttctacgagagcgagttgcacggcacggttggc
tacgaggaagtcgagaccaacgcccgcgggcgggtgctgcgggtgctcaagcgcaccgac
ccgattcccggcaaggacatcgtcctgagcatcgacagccgcctgcaggaggccgccgag
aacgccctggccgggcggcggggcgccatcgtggcgatccagccgtccaccggcgacgtg
ctggcgatggtcagccagccgagctacgaccccaacctgttcgtcaccggcatcagcttc
aaggcctatgccgagctgcgtgactccatcgaccggccgctgtacaaccgcgtcctgcgc
gggctctatccgccgggctcgacggtgaagccggcggtggcgctggccggcctcgacgcc
ggggtggtcacgccgacctcgcgggtcttcgaccccggctactaccagttgcccaactac
gaccacaagtaccgtaactggaaccgctacggcgatggctgggtgagcctggagtcggcg
atctaccggtccaacgacacctatttctacgacctcgcgcacaagctggggatcgaccgc
ctgcacgccttcatgagccgcttcggcttcggccagaaagtcgccctggacatgttcggc
gaagccgacgggctgatgccctcgcgcgaatggaagcgcaagacccgccgccaggtctgg
tacccgggcgagaccctgatcctcggcatcggccagggctacatgcaggcgacgccgatc
caactggcgcagatgaccgcgctgctggccaacaagggccactggatccgcccgcacctg
gccaagaccatcgacggccagccgccggtcgaccccgacccgatgcccgacatcgtgctg
cgcgacccggccaactgggaccgcgtcgactacggcatgcagcaggtggtgcatggcgcc
cgcggcacggcgcgcaaggtcggcgccacctcggcctacctgatcgccggcaagagcggt
accgcccaggtggtggcgatcaagcagaacgagcgctacgaccgctccaagctgctcgag
cggcaccgcgaccacgccctgttcgtcggcttcgcgccggccaacaacccgcagatcgcg
gtggcggtgatggtggagaacggcgagtccggctccggcgtcgccgccccggtggtcaag
caggtgatggacgcctggctgctcgacgagcacggcaagctcaaggccgaatacgcggaa
cccgtcgcgccgctcgcggcggcggtggccaagcccgaacccacggcagccgagccggag
gcgcccgcccttgaacagtaa

DBGET integrated database retrieval system