KEGG   Pseudomonas aeruginosa SCV20265: SCV20265_0977Help
Entry
SCV20265_0977     CDS       T02971                                 

Definition
(GenBank) D-alanyl-D-alanine carboxypeptidase
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
paes  Pseudomonas aeruginosa SCV20265
Pathway
paes00550  Peptidoglycan biosynthesis
paes01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:paes00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SCV20265_0977
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:paes01002]
    SCV20265_0977
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:paes01011]
    SCV20265_0977
Enzymes [BR:paes01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     SCV20265_0977
Peptidases and inhibitors [BR:paes01002]
 Serine peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   SCV20265_0977
Peptidoglycan biosynthesis and degradation proteins [BR:paes01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   SCV20265_0977
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 PBP5_C Beta-lactamase2 Peptidase_S13 Beta-lactamase
Motif
Other DBs
NCBI-ProteinID: AHC75091
LinkDB All DBs
Structure
PDB: 

Position
1019156..1020316
Genome map
AA seq 386 aa AA seqDB search
MNITTIAKRLSLLVLFIAPTAGWAAESMVPAPPQLAAKSYVLMDGESGQVLVENNGDQRL
PPASLTKLMTAYIATKEIEAGRIGENDLVTVSEHAWRTGGSRMFIKVGSQVSVSDLLHGI
IIQSGNDASVALAEHIAGSEDAFADMMNTTAQKLGLTNSHFMDATGLPNPDHYSSARDMA
VLARAIIYGEPSHYAIYAQKEFLWNNIKQPNRNLLLWRDKTVDGLKTGHTDEAGYCLVAS
AVRDGQRMIAVVFGTNSEQARAAETQKLLTYGFRFFESRNFYKKGTELTKGLVWKGSEHE
VKAGLAEDLTMTLPRGQMQKLQASMVLEPQLMAPIQQGQVIGKVEVKLDDKVIRSADLVA
LNAVEEGGFFRRLWDSIRLFFYGLFN
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgaacatcaccactatcgcgaaacgcttgtcactgcttgtcctgttcatcgcccctacg
gctggctgggctgctgaatccatggttccggcgccgccgcaactggccgccaagtcgtac
gtcctgatggacggcgagagcggccaggttctggtcgagaacaacggcgaccagcgcctg
ccgccggccagcctgaccaaactgatgaccgcctacatcgccaccaaggagatcgaggcc
ggccgcatcggcgagaacgacctggtcaccgtcagcgaacatgcctggcgcaccggcggt
tcgcggatgttcatcaaggtcggcagccaggtctcggtgagcgacctgctgcatggcatc
atcatccagtccggcaacgacgccagcgtcgccctggccgagcatatcgccggcagcgaa
gacgccttcgccgacatgatgaacaccaccgcgcagaagctgggcctgaccaactcccac
ttcatggacgccaccggcctgcccaacccggaccactattcctccgcccgcgacatggcg
gtgctggcccgcgcgatcatctacggcgagccgagccactacgcgatctacgcgcagaag
gaattcctctggaacaacatcaagcagccgaaccgcaacctgctgctgtggcgcgacaag
accgtcgacggcctgaagaccggccacaccgacgaagccggctactgcctggtggcttcc
gcggtacgcgacggccagcgcatgatcgccgtggtgttcggcaccaacagcgagcaggcc
cgcgccgccgagacccagaagctgctgacctatggcttccgcttcttcgaaagccgcaac
ttctacaagaagggcaccgagctgaccaagggcctggtctggaagggttccgagcatgaa
gtgaaagccggcctcgccgaagacctgaccatgaccctgccgcgcggccagatgcagaag
ctgcaggccagcatggtcctggagccgcagctgatggcgccgatccagcagggccaggtg
atcggcaaggtggaagtgaagctggacgacaaggtcatccgcagcgccgacctggtcgcc
ctcaacgccgtcgaggagggtggtttcttccgccgcctgtgggatagcatccgcctgttc
ttctacggtttgttcaactga

DBGET integrated database retrieval system