KEGG   Pseudomonas aeruginosa SCV20265: SCV20265_1204Help
Entry
SCV20265_1204     CDS       T02971                                 

Definition
(GenBank) Oxidoreductase
Organism
paes  Pseudomonas aeruginosa SCV20265
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldo_ket_red
Motif
Other DBs
NCBI-ProteinID: AHC75318
LinkDB All DBs
Position
complement(1263092..1264042)
Genome map
AA seq 316 aa AA seqDB search
MTTRKLGNSGLEIPALVFGGNVFGWTADESTSFRLLDALLDAGLNCIDTADVYSRWVPGH
QGGESETLIGKWLKRTGKRDRMVIASKVGMDMGNGHKGLSAAYIEQALERSLRRLQTDYL
DLYQSHTDDPHTDLEETLSTYGELIKKGKVRVIGASNYDARRLLEARQVSARLNLPSYQS
LQPEYNLYDRADYETNLEPTVEELGIGVISYYSLASGFLSGKYRNQADTAGRARGEKVKG
YLNERGVAILAALDEVAEQYNANPTQVALAWLIARPTVTAPIASATSLEQLDDLIAATHL
KLDEQAIHRLDSASAY
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgaccacacgcaaactcggcaactccggcctggagataccggcactggtattcggcggc
aacgtcttcggctggactgccgacgaaagcacctccttcaggctgctggacgccctgctc
gacgccggcctgaactgcatcgacaccgccgacgtatattcgcgctgggttcccgggcac
cagggcggcgagtcggaaaccctcatcggcaagtggctgaaacgcaccggcaaacgcgac
cgcatggtgatcgccagcaaggtcgggatggacatgggcaatggccacaaaggtctctcc
gccgcctatatcgagcaggccctggagcgctcgctacgacgcctgcagaccgactacctg
gacctctaccagtcgcacaccgacgatccccacaccgacctggaggaaaccctttccacc
tatggcgaactgatcaagaaaggcaaggtacgggtcatcggcgcctccaactacgacgcc
cggcgcctcctcgaagcacgccaggtcagcgcccggcttaacctgccgagctaccagagc
ctgcaacccgaatacaacctgtacgatcgcgccgactacgagaccaacctggagccgacg
gtggaagaactcggtatcggggtgatcagctactactcgctggccagcggcttcctcagc
ggcaagtaccgcaaccaggccgacaccgccgggcgagcccggggagagaaggtgaagggt
tatctcaacgagcgcggcgtggccatcctcgcggcgctcgacgaagtggccgagcagtac
aacgccaacccgacccaggtcgccctggcctggctcatcgctcgtccgacggtgaccgcg
ccgatcgccagcgccaccagcctggaacagctcgacgacctgatcgccgccacccacctg
aagctcgacgaacaggcgatccaccgcctggacagcgccagcgcctattga

DBGET integrated database retrieval system