KEGG   Pseudomonas aeruginosa SCV20265: SCV20265_1998Help
Entry
SCV20265_1998     CDS       T02971                                 

Definition
(GenBank) D-alanyl-D-alanine carboxypeptidase
  KO
K07259  serine-type D-Ala-D-Ala carboxypeptidase/endopeptidase (penicillin-binding protein 4) [EC:3.4.16.4 3.4.21.-]
Organism
paes  Pseudomonas aeruginosa SCV20265
Pathway
paes00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:paes00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SCV20265_1998
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:paes01002]
    SCV20265_1998
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:paes01011]
    SCV20265_1998
Enzymes [BR:paes01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     SCV20265_1998
   3.4.21  Serine endopeptidases
    3.4.21.-  
     SCV20265_1998
Peptidases [BR:paes01002]
 Serine Peptidases
  Family S13: D-Ala-D-Ala peptidase C family
   SCV20265_1998
Peptidoglycan biosynthesis and degradation proteins [BR:paes01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   SCV20265_1998
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S13 Beta-lactamase2 SdpA
Motif
Other DBs
NCBI-ProteinID: AHC76112
LinkDB All DBs
Position
complement(2121282..2122712)
Genome map
AA seq 476 aa AA seqDB search
MFKSLRTLAFATLLPFALPTLAQVNATLPANVQKALQTNKLTGNDLSLVLIPLDGPGNPT
YYNADVSVNPASTMKLFTTYAALEMLGPTYQWKTEFYTDGQLKNGVLNGNLYLKGGGDPK
LNMEKLWLLMRDLRANGVTKVTGDLVLDRSYFNIPQLPVFNDDGGDDTKPFLVGPDSLLV
NLKSVRMVVRTDGNKVNVQMDPPLANVRIDNQVKMTAPATCPAWPKLRFSPVTQFDGTTL
LATGQIPQGCSAQTYMSLLDHPGYTAGAVRGIWQELGGSILGKDRQGSVPRNATLIAKAF
SPDLVEIIRDINKYSNNTMARQLFLSIGAQFRNSADGDDAQAAQRVVRQWLARKGITAPR
LVMENGSGLSRQERVSAREMAAMLQAAWHSPYAAEYISSLPLAGLDGTMRKRLRRTALVG
EAHVKTGTLNTVRALAGFSRDASGHNWVVVAILNSPRPWGASAILDQVLLSLHARK
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgttcaagtcgctgcgtactcttgccttcgccacgctcctgcctttcgcccttcccacc
ctcgcccaggtcaacgccaccctgccggccaacgtgcagaaagccctgcagaccaacaag
ctgaccggcaacgatctgtcgctggtgctgattccgctcgacggcccgggcaaccccacc
tactacaacgccgacgtatcggtgaacccggcctcgaccatgaagctgttcaccacctat
gccgccctggaaatgctcggcccgacctaccagtggaagaccgagttctacaccgacggc
cagctcaagaacggagtgctcaacggcaacctctacctcaagggcggcggcgatccgaaa
ctgaacatggagaagctctggctgctgatgcgcgacctgcgcgccaatggcgtgaccaag
gtcacaggtgacctggtactcgaccgcagctacttcaacatcccgcagttgccggtattc
aacgacgacggcggcgacgacaccaagccgttcctggtcggtccggactcgctgctggtc
aacctgaagagcgtgcgcatggtggtgcgcaccgacggcaacaaggtcaacgtgcagatg
gacccgccgctggccaacgtacgcatcgacaaccaggtgaagatgaccgcgccggccacc
tgcccagcctggccgaagctgcgcttcagcccggtgacccagttcgacggcaccaccctg
ctggccaccggacagattccccagggctgtagcgcgcagacctacatgtcgctgctcgac
caccccggctacaccgccggcgcggtgcgcggcatctggcaggaactgggcggcagcatc
ctcggcaaggaccgccagggcagcgtaccgcgcaacgccacgctgatcgccaaggccttc
tcgccagacctggtcgagatcatccgcgacatcaacaaatacagtaacaacaccatggcc
cgacagttgttcctctccatcggcgcgcagttccgcaacagcgccgacggcgacgacgcc
caggccgcgcagcgggtggtgcggcagtggctggcgcgcaagggcatcaccgcgccgcgc
ctggtgatggagaacggctcgggactgtcgcgccaggaacgggtcagcgcccgtgagatg
gcggcgatgctgcaagccgcctggcacagcccctatgcagcggagtacatctcctcgctg
ccgctggccggcctcgacggcaccatgcgcaaacgcctgcggcgcaccgcactggtcggc
gaggcgcacgtgaagaccggcaccctcaacaccgtgcgcgccctcgccggcttcagccgc
gacgccagcggccacaactgggtggtggtggcgatcctcaacagcccgcggccgtggggc
gcttcggcgatcctcgaccaggtactgctgagcctgcacgcgcggaaataa

DBGET integrated database retrieval system