KEGG   Pseudomonas aeruginosa SCV20265: SCV20265_2629Help
Entry
SCV20265_2629     CDS       T02971                                 

Definition
(GenBank) Isocitrate dehydrogenase [NADP]
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
paes  Pseudomonas aeruginosa SCV20265
Pathway
paes00020  Citrate cycle (TCA cycle)
paes00480  Glutathione metabolism
paes01100  Metabolic pathways
paes01110  Biosynthesis of secondary metabolites
paes01120  Microbial metabolism in diverse environments
paes01130  Biosynthesis of antibiotics
paes01200  Carbon metabolism
paes01210  2-Oxocarboxylic acid metabolism
paes01230  Biosynthesis of amino acids
Module
paes_M00009  Citrate cycle (TCA cycle, Krebs cycle)
paes_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:paes00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SCV20265_2629
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    SCV20265_2629
Enzymes [BR:paes01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     SCV20265_2629
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH
Motif
Other DBs
NCBI-ProteinID: AHC76743
LinkDB All DBs
Position
complement(2729211..2731436)
Genome map
AA seq 741 aa AA seqDB search
MSIRSKITYTFTDEAPALATYSLLPIVKAFAASAGIDVETSDISLAGRILANFADRLEAD
QRIEDDLARLAVLATSPDANIIKLPNISASVPQLKGAIAELQGLGYKVPDFPEDPQTDEE
KEVRARYAKILGSAVNPVLREGNSDRRAPAAVKAYARKHPHSMGKWSMASRSHADYMRGG
DFFSSEQSITMAKAGDVRIEFVGKDGKVEVKKQLSLQEGEVLDSMFMSCGKLRDFFEKTL
QDCKETGVMWSLHVKATMMKISHPIVFGHAVSVYYKDVFDKWGQLFEELGVNPNNGISSV
YDKIKSLPASQQEEILHDIHEVYSHRPEMAMVDSVKGITNLHIPSDVIVDASMPAMIRNS
GQMWGKDGKQKDTKAVMPESTYARIYQEMINFCKTNGAFDPTTMGSVPNVGLMAQKAEEY
GSHDKTFEMTADGTMRVVLADGSVLMQHEVETGDIWRACQTKDAPIRDWVKLAVTRARQS
DTPAIFWLDPERAHDRELRKKVELYLKDHDLTGLDISIMGYNEAIRVSMERLIRGKDTIS
VTGNVLRDYLTDLFPIMELGTSAKMLSIVPLMAGGGMYETGAGGSAPKHVQQLVEENYLR
WDSLGEFLALAVSLEETGIKTGNAKAKLLGKALDEATGKLLDNNKSPSRKVGDIDNRGSH
FYLAMYWAQALAAQDEDAELKAHFAPLAKALTEQEATIVAELNAVQGKPAEIGGYYRSNP
ELTSKVMRPSATFNAAIDSLA
NT seq 2226 nt NT seq  +upstreamnt  +downstreamnt
atgtccatccgctcgaagatcacctacaccttcaccgacgaagcacccgcgctcgccacc
tactcgctcctccccatcgtcaaggcctttgccgcttccgccggcatcgacgtcgagacc
agcgacatctctcttgcaggacgcatcctggccaacttcgccgaccgcctcgaagccgac
cagcgtatcgaagacgacctcgcccgcctggcggtcctggccacctcgcccgacgccaat
atcatcaagctgcccaacatcagcgcctcggtgccccagctgaaaggcgcgatcgccgag
ctgcagggcctgggctacaaggttcccgacttcccggaagacccgcagaccgacgaagag
aaagaggttcgcgcacgctacgcgaagatcctcggcagcgccgtgaacccggtcctgcgc
gaaggcaattccgaccgtcgcgcgcctgccgcagtgaaggcctacgcccgcaagcacccg
cactccatgggcaagtggagcatggcctcgcgctcccacgccgactacatgcgcggcggc
gacttcttctccagcgaacagtccatcaccatggccaaggccggtgacgtgcgcatcgaa
ttcgtcggcaaggacggcaaggtcgaggtcaagaagcaactgagcctgcaggaaggcgaa
gtgctcgacagcatgttcatgagctgcggcaagctgcgcgacttcttcgagaagaccctg
caggactgcaaggaaaccggcgtcatgtggtccctgcacgtcaaggcgaccatgatgaag
atttcccacccgatcgtcttcggacatgcggtgagcgtctactacaaggacgtcttcgac
aagtggggccaactcttcgaagagctcggcgtgaacccgaacaacggtatctccagcgtc
tacgacaagatcaagtcgctgcccgcctcccagcaggaagagatcctccacgacatccac
gaggtgtacagccaccgcccggaaatggcgatggtcgactccgtgaaaggcatcaccaac
ctgcacattccgagcgacgtcatcgtcgacgcctcgatgccggcgatgatccgcaactcc
ggccagatgtggggcaaggacggcaagcagaaagacaccaaggcggtaatgccggaaagc
acctacgcccgcatctaccaggagatgatcaacttctgcaagaccaacggcgccttcgac
ccgaccaccatgggcagcgtgccgaacgtcggcctgatggcgcagaaggccgaggaatac
ggctcccacgacaagaccttcgaaatgaccgccgacggcaccatgcgcgtagtcctggcc
gacggcagcgtgctgatgcagcacgaggtggagaccggcgacatctggcgcgcctgccag
accaaggacgcaccgatccgcgactgggtcaagctggccgtcacccgcgcacgccagtcc
gataccccggcgatcttctggctggacccggagcgcgcccacgaccgcgaactgcgcaag
aaggtcgagctgtacctcaaggaccacgacctgaccggtctcgacatcagcatcatgggc
tacaacgaggccattcgcgtcagcatggaacgcctgatccgcggcaaggacaccatctcg
gtgaccggcaacgtcctgcgcgactacctgaccgacctgttcccgatcatggaactgggc
acctcggccaagatgctctccatcgttccgctgatggcgggcggcggcatgtacgaaacc
ggcgccggcggctcggcacccaagcacgtccagcaactggtggaagagaactacctgcgc
tgggactccctgggcgagttcctggccctggccgtgtccctggaggaaaccgggatcaag
accggcaacgccaaggccaagctgctcggcaaggcgctggacgaagccaccggcaagctg
ctggacaacaacaagtcgccgtcgcgcaaggtcggcgacatcgacaaccgcggcagccac
ttctacctggcgatgtactgggcccaggccctggccgcccaggacgaagacgccgagctg
aaagcgcacttcgcgccgctggccaaggccctgaccgagcaggaagcgaccatcgtcgcc
gaactcaatgcggtccagggcaagccggccgagatcggcggctactatcgctccaacccg
gagctgaccagcaaggtgatgcgccccagcgccaccttcaacgcggcgatcgacagcctg
gcctga

DBGET integrated database retrieval system