KEGG   Pseudomonas aeruginosa SCV20265: SCV20265_4404Help
Entry
SCV20265_4404     CDS       T02971                                 

Definition
(GenBank) Glutathione S-transferase
  KO
K11209  GSH-dependent disulfide-bond oxidoreductase [EC:1.8.4.-]
Organism
paes  Pseudomonas aeruginosa SCV20265
Brite
KEGG Orthology (KO) [BR:paes00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    SCV20265_4404
Enzymes [BR:paes01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.-  
     SCV20265_4404
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_C GST_N_2 GST_C_3 GST_C_2 Helicase_C_3
Motif
Other DBs
NCBI-ProteinID: AHC78514
LinkDB All DBs
Position
4670149..4670790
Genome map
AA seq 213 aa AA seqDB search
MIDLYYWTTPNGHKITLFLEETGLPYAIHPINISQGDQFQADFLKVSPNNKIPAIVDRQP
ADGGAPLSLFESGAILLYLAEKTGRFLAKDLRARQETLQWLFWQMGGLGPMAGQNHHFNR
FAPEKIPYAIDRYVKETARLYGVLDQRLADRAFVAGDDYSIADMAIYPWIVPHQWQEQDL
ADFPHLQRWFESIRQRPATQRAYALVERINPPQ
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgatcgacctgtactactggaccaccccgaacggccacaagattactcttttcctggaa
gaaaccggcctgccctacgccatccatccgatcaacatcagccagggcgaccagttccag
gcggatttcctgaaggtgtcgccgaacaacaagattcccgccatcgtcgatcgccaaccg
gccgacggcggcgctcccctgtcgctgttcgagtccggcgccatcctgctctatctcgcg
gaaaagaccggacgcttcctcgccaaggacctgcgcgcgcgccaggaaaccctgcagtgg
ctgttctggcagatgggcgggctggggccgatggcagggcagaaccaccatttcaaccgc
ttcgccccggagaagattccctacgccatcgaccggtacgtcaaggaaaccgcgcgcctg
tacggcgttctcgaccagcgcctggcggaccgcgccttcgtcgccggcgacgactacagc
atcgccgacatggccatctatccgtggatcgtcccgcaccagtggcaggagcaggatctc
gccgacttcccacacctgcagcgctggttcgagagcattcgccagcgtccggcgacgcaa
cgcgcctatgctttggtggagcgcatcaatccgccgcagtag

DBGET integrated database retrieval system