KEGG   Pasteurella aerogenes: NCTC13378_01877
Entry
NCTC13378_01877   CDS       T05989                                 

Gene name
dapF
Definition
(GenBank) diaminopimelate epimerase
  KO
K01778  diaminopimelate epimerase [EC:5.1.1.7]
Organism
paet  Pasteurella aerogenes
Pathway
paet00300  Lysine biosynthesis
paet01100  Metabolic pathways
paet01110  Biosynthesis of secondary metabolites
paet01120  Microbial metabolism in diverse environments
paet01230  Biosynthesis of amino acids
Module
paet_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:paet00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    NCTC13378_01877 (dapF)
Enzymes [BR:paet01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.7  diaminopimelate epimerase
     NCTC13378_01877 (dapF)
SSDB
Motif
Pfam: DAP_epimerase
Other DBs
NCBI-ProteinID: VEG72511
UniProt: A0A448K6C3
LinkDB
Position
1:complement(1957270..1958094)
AA seq 274 aa
MQFSKMHGLGNDFVVVDAMTQNVYFPTETIKKLADRHCGIGFDQLLIVEPPYDPELDFHY
RIFNADGSEVAQCGNGARCFARFVTLKGLTNKKDIAVSTTNGKMILSVKDDGMIRVNMGE
PIWEPAKIPFIANKFEKNYILRTDIQTVLCGAVSMGNPHCVVQVDDIATANVAELGPLLE
SHERFPERVNAGFMQVMNRQHIKLRVYERGAGETQACGSGACAAVAVGIMQGLLDNNVQV
DLPGGRLTIEWEGVGSPLYMTGDATHIYDGVIRL
NT seq 825 nt   +upstreamnt  +downstreamnt
atgcagttttctaaaatgcacggtttaggcaatgattttgttgtcgtcgatgcaatgact
caaaatgtttattttcccactgaaaccatcaaaaaattagcggatcgccattgcggaatt
ggttttgatcaattattaattgttgagccaccttatgatccggaattggattttcattat
cgtattttcaacgcagacggtagcgaagtggcacaatgtggcaatggcgcacgttgtttt
gctcgttttgtaaccctcaaagggttgaccaacaaaaaagatatcgcggtcagtaccaca
aacggaaaaatgattttaagtgttaaagatgatggaatgatccgcgtgaatatgggggaa
cctatttgggagccagcaaaaatcccatttattgctaataaatttgaaaaaaattatatt
ttgcgtactgacattcaaacggtactttgtggtgctgtatcaatgggtaatccacactgc
gtcgttcaggttgacgatattgctactgccaatgttgccgaacttggacctttattggaa
agtcatgaacgttttccggagcgtgtgaatgctggatttatgcaagtgatgaatcgccaa
catattaaattacgggtttacgaacgtggtgccggagaaactcaggcttgcggcagcggt
gcttgtgcggctgtggcagtcggtattatgcaaggtttgctggataataacgtacaagtt
gatttgccgggtggtcgcttaacgattgaatgggaaggcgtcggttcgccactttatatg
accggtgatgctacacatatttacgatggtgttattcggctttag

DBGET integrated database retrieval system