KEGG   Pasteurella aerogenes: NCTC13378_01925
Entry
NCTC13378_01925   CDS       T05989                                 

Gene name
atpA
Definition
(GenBank) ATP synthase subunit alpha
  KO
K02111  F-type H+/Na+-transporting ATPase subunit alpha [EC:7.1.2.2 7.2.2.1]
Organism
paet  Pasteurella aerogenes
Pathway
paet00190  Oxidative phosphorylation
paet01100  Metabolic pathways
Module
paet_M00157  F-type ATPase, prokaryotes and chloroplasts
Brite
KEGG Orthology (KO) [BR:paet00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    NCTC13378_01925 (atpA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:paet00194]
    NCTC13378_01925 (atpA)
Enzymes [BR:paet01000]
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.1.2.2  H+-transporting two-sector ATPase
     NCTC13378_01925 (atpA)
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.1  Na+-transporting two-sector ATPase
     NCTC13378_01925 (atpA)
Photosynthesis proteins [BR:paet00194]
 Photosystem and electron transport system
  F-type ATPase [OT]
   NCTC13378_01925 (atpA)
SSDB
Motif
Pfam: ATP-synt_ab ATP-synt_ab_C ATP-synt_ab_N ATPase ATPase_2
Other DBs
NCBI-ProteinID: VEG72586
UniProt: A0A448K6M9
LinkDB
Position
1:complement(2003857..2005398)
AA seq 513 aa
MQLNSTEISELIKKRIAQFDVVSEARNTGTIISVSDGIIRIHGLSDVMQGEMIALPGNRY
AMALNLERDSVGAVVMGPYADLAEGMEVQCTGRILEVPVGRGLLGRVVNTLGQPIDGKGE
IENDGFSPVEVIAPGVIDRKSVDQPVQTGYKAVDSMVPIGRGQRELIIGDRQTGKTALAI
DAIINQRDSGIKCIYVAIGQKASTIANVVRKLEEHGALKNTIVVVASASESAALQYLAPY
AGCAMGEYFRDRGEDALIVYDDLSKQAVAYRQISLLLRRPPGREAFPGDVFYLHSRLLER
ASRVSEEYVERFTKGEVKGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLESNLF
NSGIRPAVNPGISVSRVGGAAQTKVVKKLAGGIRTALAQYRELAAFAQFASDLDDATRKQ
LSHGQKVTELLKQKQYSPLSVAEQALVLFAVECGYLDDVELDRIGSFEAALLEYANHNNA
DFMRELTNTGNYNDDIKGTLKGILDSFKANSSW
NT seq 1542 nt   +upstreamnt  +downstreamnt
atgcaactaaattcaactgaaattagtgaattgattaaaaaacggattgctcagtttgac
gtggtcagcgaagctcgcaatacgggaacgattatttctgtaagcgacggtattattcgt
atccatggattaagcgatgtaatgcaaggggaaatgattgcattaccgggtaatcgttac
gctatggcacttaaccttgaaagagattcggtaggtgcggtagtgatggggccttatgcc
gatttagcagaagggatggaagttcaatgtaccggacgtattttagaagttccagttggt
cgtggtttattaggtcgtgtagtaaatacccttggtcaaccgattgacggaaaaggcgaa
attgaaaatgatggattttctccagttgaagtaattgcgccgggggtaattgatcgtaaa
tctgttgatcagccggttcaaactggttataaagcagttgactccatggttccaatcggt
cgtggtcaacgtgagttgattatcggcgaccgtcaaacaggtaaaactgcattagcgatt
gatgcgattattaaccaacgtgattccggtattaaatgtatttatgtagcgattggtcaa
aaagcatcaacgattgctaacgtggtgcgtaaattagaagaacatggtgcgttaaaaaat
actatcgttgttgtggcatctgcttctgaatctgcggcgttacaatatcttgcaccttat
gctggttgtgctatgggtgaatatttccgtgatcgcggtgaagatgcattgattgtttat
gatgatttatctaaacaagcggtcgcttatcgtcaaatttcattgttattacgtcgtcca
ccaggtcgtgaagcattcccgggtgacgtattctatttacactctcgtttacttgagcgt
gcatcacgtgttagtgaggaatatgttgaacgtttcactaaaggtgaagtgaaaggaaaa
accggttctttgaccgcacttccgattattgaaacgcaagccggtgacgtatctgccttc
gttccaactaacgtgatttcaattaccgatggtcagattttcttggaatctaacttattt
aactctggtattcgtccagcggttaacccgggtatttcggtatctcgtgtgggtggagcg
gcacaaaccaaagtggtgaaaaaattagcgggtggtattcgtactgcacttgctcaatat
cgtgaattagcggcgtttgctcagtttgcctcagatcttgatgatgcgactcgtaaacaa
ttgtctcacggtcaaaaagtaaccgaattattgaaacaaaaacaatattcaccgttaagc
gtagctgaacaggcattagtcttgtttgcggttgaatgtggttatttagatgatgttgag
ttagatcgtattggttcttttgaagctgctcttttagagtatgctaaccacaataatgct
gactttatgcgcgaacttaccaataccggtaattacaatgatgacattaaaggcacattg
aaaggtattttagatagttttaaagcaaatagttcgtggtaa

DBGET integrated database retrieval system